Apache2 Debian Default Page: It works


Domain summary

SafetyLow trust score
Year Founded
2022
Global Traffic Rank
Unknown
Estimated Worth
$9
Last updated
2022-02-19
Domain label
empfangsanlage
Domain extension
de
Statvoo Rating
I
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Empfangsanlage.de registered?
A: Empfangsanlage.de was registered 5 months, 3 weeks, 2 days, 9 hours, 25 minutes, 15 seconds ago on Saturday, February 19, 2022.
Q: When was the WHOIS for Empfangsanlage.de last updated?
A: The WHOIS entry was last updated 1 year, 3 months, 1 week, 4 days, 9 hours, 25 minutes, 15 seconds ago on Monday, May 3, 2021.
Q: What are Empfangsanlage.de's nameservers?
A: DNS for Empfangsanlage.de is provided by the following nameservers:
  • ns5.kasserver.com
  • ns6.kasserver.com
Q: Who is the registrar for the Empfangsanlage.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Empfangsanlage.de?
A: Empfangsanlage.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Empfangsanlage.de each day?
A: Empfangsanlage.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Empfangsanlage.de resolve to?
A: Empfangsanlage.de resolves to the IPv4 address 31.204.120.11.
Q: In what country are Empfangsanlage.de servers located in?
A: Empfangsanlage.de has servers located in the Germany.
Q: What webserver software does Empfangsanlage.de use?
A: Empfangsanlage.de is powered by Apache webserver.
Q: Who hosts Empfangsanlage.de?
A: Empfangsanlage.de is hosted by recast IT GmbH & Co. KG in Germany.
Q: How much is Empfangsanlage.de worth?
A: Empfangsanlage.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Empfangsanlage.de?

Empfangsanlage.de Hosting Provider Information

Hosted IP Address:31.204.120.11
Hosted Hostname:s1.indicato.de
Service Provider:recast IT GmbH & Co. KG
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "recast IT GmbH & Co. KG" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
20.7263%
GOOGLE
14.6821%
AS-26496-GO-DADDY-COM-LLC
3.5109%
NAMECHEAP-NET
3.2517%
AMAZON-AES
2.3474%
UNIFIEDLAYER-AS-1
2.0808%
GoDaddy.com, LLC
2.0465%
Fara Negar Pardaz Khuzestan
1.7230%
AMAZON-02
1.6509%
CONFLUENCE-NETWORK-INC
1.5204%
recast IT GmbH & Co. KG
0.0002%

Empfangsanlage.de Domain Nameserver Information

HostIP AddressCountry
ns5.kasserver.com 85.13.128.3
ns6.kasserver.com 85.13.159.101

Common Spelling Mistakes for Empfangsanlage.de

wmpfangsanlage.desmpfangsanlage.dedmpfangsanlage.defmpfangsanlage.de
rmpfangsanlage.deenpfangsanlage.deehpfangsanlage.deejpfangsanlage.de
ekpfangsanlage.deelpfangsanlage.deemofangsanlage.deemlfangsanlage.de
empcangsanlage.deempdangsanlage.deempeangsanlage.deemprangsanlage.de
emptangsanlage.deempgangsanlage.deempbangsanlage.deempvangsanlage.de
empfqngsanlage.deempfwngsanlage.deempfzngsanlage.deempfxngsanlage.de
empfabgsanlage.deempfaggsanlage.deempfahgsanlage.deempfajgsanlage.de
empfamgsanlage.deempfanrsanlage.deempfanfsanlage.deempfanvsanlage.de
empfantsanlage.deempfanbsanlage.deempfanysanlage.deempfanhsanlage.de
empfannsanlage.deempfangqanlage.deempfangwanlage.deempfangeanlage.de
empfangzanlage.deempfangxanlage.deempfangcanlage.deempfangsqnlage.de
empfangswnlage.deempfangsznlage.deempfangsxnlage.deempfangsablage.de
empfangsaglage.deempfangsahlage.deempfangsajlage.deempfangsamlage.de
empfangsanpage.deempfangsanoage.deempfangsaniage.deempfangsankage.de
empfangsanmage.deempfangsanlqge.deempfangsanlwge.deempfangsanlzge.de
empfangsanlxge.deempfangsanlare.deempfangsanlafe.deempfangsanlave.de
empfangsanlate.deempfangsanlabe.deempfangsanlaye.deempfangsanlahe.de
empfangsanlane.deempfangsanlagw.deempfangsanlags.deempfangsanlagd.de
empfangsanlagf.deempfangsanlagr.deempfangsanlage.xeempfangsanlage.se
empfangsanlage.weempfangsanlage.eeempfangsanlage.reempfangsanlage.fe
empfangsanlage.veempfangsanlage.ceempfangsanlage.dwempfangsanlage.ds
empfangsanlage.ddempfangsanlage.dfempfangsanlage.dr 

Websites with Similar Names to Empfangsanlage.de

Empfacts.com
empfacts.com - Registered at Namecheap.com
Empfammexico.com
EMPRESAS FAMILIARES MEXICO – Profesionalización de Empresas Familiares
Empfangen.com
Buy Domains - empfangen.com is for sale!
Empfangsanlage.de
Apache2 Debian Default Page: It works
Empfangshalle.de
Empfangshalle - Künstlerduo Böhm und Gruber
Empfangspersonal-frankfurt.de
Frankfurt am Main - ESD Empfangs- und SekretariatsDienstleistungen GmbH
Empfangspersonal-hamburg.de
Hamburg - ESD Empfangs- und SekretariatsDienstleistungen GmbH
Empfangsprognose.de
empfangsprognose.de
Empfangstheken.net
Start | Günstige Empfangstheken in allen Größen und Farben