AssetCare | Home

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Full-service provider en specialist in het structureren en administreren van fondsen.



Domain summary

Last updated
2021-11-15
Domain label
enabl
Domain extension
solutions
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Enabl.solutions registered?
A: Enabl.solutions was registered 2 months, 1 week, 1 day, 11 hours, 19 minutes, 13 seconds ago on Monday, November 15, 2021.
Q: When was the WHOIS for Enabl.solutions last updated?
A: The WHOIS entry was last updated 2 months, 1 week, 1 day, 11 hours, 19 minutes, 13 seconds ago on Monday, November 15, 2021.
Q: What are Enabl.solutions's nameservers?
A: DNS for Enabl.solutions is provided by the following nameservers:
  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com
Q: Who is the registrar for the Enabl.solutions domain?
A: The domain has been registered at .
Q: What is the traffic rank for Enabl.solutions?
A: Enabl.solutions has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Enabl.solutions each day?
A: Enabl.solutions receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Enabl.solutions resolve to?
A: Enabl.solutions resolves to the IPv4 address 192.0.78.194.
Q: In what country are Enabl.solutions servers located in?
A: Enabl.solutions has servers located in the United States.
Q: What webserver software does Enabl.solutions use?
A: Enabl.solutions is powered by Openresty webserver.
Q: Who hosts Enabl.solutions?
A: Enabl.solutions is hosted by AUTOMATTIC in United States.
Q: How much is Enabl.solutions worth?
A: Enabl.solutions has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Enabl.solutions Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Enabl.solutions Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Enabl.solutions

H1 Headings

1 :
  1. Focus op uw beleggingen en delegeer de rest

H2 Headings

2 :
  1. Start een fonds in 3 maanden
  2. Terugkerende fondsdiensten

H3 Headings

8 :
  1. Fund startups
  2. Beleggingsfondsen
  3. Instituten
  4. "AssetCare is volledig geïntegreerd in de dagelijkse processen van onze VanEck digital assets ETN's."
  5. "Het opzetten van ons cryptofonds en bijbehorende processen verliep soepel en snel."
  6. "De structuur van Bestevaer Capital Fund staat als een ‘huis’, met dank aan AssetCare"
  7. Hoe start ik een beleggingsfonds?
  8. Hoe voorkomt u witwassen en terrorismefinanciering in uw fonds?

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

56 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-155743179-1

Links - Internal

23:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Enabl.solutions

aaneachpreventlinkuwprevent default epreventdefaultactive language linkweglot weglotinitialize apikeyafteradd a clickbestevaeriflanguage afterallclick eventlinkslanguage const currentlanginit weglotoninitialized getactive languageweglotgetcurrentlang ifif the currentdefault epreventdefaultprevent defaultwg62d9b9b0750831f48721322c8384946b6init weglotoninitializedlinkaddeventlistenerclickuifdocumentqueryselectorwgelementwrappersw1 langcurrentlang clicklanguage linklanguage linkslink exists ifdocumentqueryselectorwgelementwrappersw1getlangcurrentlangclickepreventdefault switchfunctione prevent defaultvolledigaanpakclickvanwgelementwrapper language linkslangcurrentlangclick for eachlangcurrentlangdefaultget the currentdocumentqueryselectorallwgelementwrappersw1 langforeachlink addexists ifdocumentqueryselectorwgelementwrappersw1backgroundevent listener linkaddeventlistenerclickcloudaddlinkaddeventlistenerclick functione preventlanguageweglotkunnenapikey wg62d9b9b0750831f48721322c8384946b6current active languagefilterifdocumentqueryselectorwgelementwrappersw1 langcurrentlangautoinitapikeysettimeoutheteenfunctione preventclick the linkswitchdocumentqueryselectorwgelementwrappersw1 langcurrentlangclicklangforeachlink2weglotinitialize apikeylanguage link existsfondsstylessnippetdisplaysettimeoutweglotswitchtothisgetattributelang160weglot initonsdocumentqueryselectorallwgelementwrappersw1 langforeachlinkonzedocumentqueryselectorwgelementwrappersw1wg62d9b9b0750831f48721322c8384946b6 on weglotcurrentweglotgetcurrentlangbinneneventlistener linkaddeventlistenerclickepreventdefaultexistsepreventdefault switch currentclick event listenerfondsenfondsbeheerdersopdefault epreventdefault switchlanguage links documentqueryselectorallwgelementwrappersw1switch currentfunctione1metcurrentlangheighthunzijnfundsettimeout settimeoutweglotswitchtothisgetattributelang160listener linkaddeventlistenerclick functionecurrent activeweglotinitializeevent listenerweglotoninitializedprocessenelement0ifdocumentqueryselectorwgelementwrappersw1weglotoninitialized gettextcapitaldocumentqueryselectorallwgelementwrappersw1init weglotwgelementwrapper languagevaneckwidthweglotinitialize apikey wg62d9b9b0750831f48721322c8384946b6contentexists ifdocumentqueryselectorwgelementwrappersw1 langcurrentlangconstlistenerconst currentlanglangforeachlink addcolorlink existslinks documentqueryselectorallwgelementwrappersw1 langforeachlinkswitch current activebestevaer capitalactive language constiklink documentqueryselectorwgelementwrappersw1 langcurrentlangclickwgelementwrappervoorlink documentqueryselectorwgelementwrappersw1after a settimeoutcurrentlang weglotgetcurrentlangweglot init weglotoninitializedlanguage constinheritlinks documentqueryselectorallwgelementwrappersw1active language afterteactivewijcurrentlang weglotgetcurrentlang ifbijinit weglot weglotinitializelangcurrentlang clickweglot weglotinitializelinkaddeventlistenerclick functioneconst currentlang weglotgetcurrentlang

Longtail Keyword Density for Enabl.solutions

KeywordsOccurences
current active language12
init weglot weglotinitialize4
listener linkaddeventlistenerclick functione4
language links documentqueryselectorallwg-element-wrappersw14
links documentqueryselectorallwg-element-wrappersw1 langforeachlink4
documentqueryselectorallwg-element-wrappersw1 langforeachlink add4
add a click4
click event listener4
event listener linkaddeventlistenerclick4
linkaddeventlistenerclick functione prevent4
langcurrentlangclick for each4
functione prevent default4
prevent default epreventdefault4
default epreventdefault switch4
epreventdefault switch current4
switch current active4
active language after4
wg-element-wrapper language links4
click the link4
link documentqueryselectorwg-element-wrappersw1 langcurrentlangclick4
weglot weglotinitialize apikey4
weglot init weglotoninitialized4
init weglotoninitialized get4
get the current4
active language const4
language const currentlang4
const currentlang weglotgetcurrentlang4
currentlang weglotgetcurrentlang if4
if the current4
active language link4
language link exists4
link exists ifdocumentqueryselectorwg-element-wrappersw14
exists ifdocumentqueryselectorwg-element-wrappersw1 langcurrentlang4
ifdocumentqueryselectorwg-element-wrappersw1 langcurrentlang click4
after a settimeout4
wg62d9b9b0750831f48721322c8384946b6 on weglot3
weglotinitialize apikey wg62d9b9b0750831f48721322c8384946b63
active language12
current active12
init weglot4
linkaddeventlistenerclick functione4
links documentqueryselectorallwg-element-wrappersw14
documentqueryselectorallwg-element-wrappersw1 langforeachlink4
langforeachlink add4
click event4
event listener4
listener linkaddeventlistenerclick4
prevent default4
functione prevent4
wg-element-wrapper language4
default epreventdefault4
epreventdefault switch4
switch current4
language after4
settimeout settimeoutweglotswitchtothisgetattributelang1604
language links4
link documentqueryselectorwg-element-wrappersw14
documentqueryselectorwg-element-wrappersw1 langcurrentlangclick4
const currentlang4
weglotinitialize apikey4
weglot init4
init weglotoninitialized4
weglotoninitialized get4
language const4
currentlang weglotgetcurrentlang4
weglot weglotinitialize4
weglotgetcurrentlang if4
language link4
link exists4
exists ifdocumentqueryselectorwg-element-wrappersw14
ifdocumentqueryselectorwg-element-wrappersw1 langcurrentlang4
langcurrentlang click4
apikey wg62d9b9b0750831f48721322c8384946b63
bestevaer capital3
van23
een22
language16
current12
active12
het11
click10
op10
link9
onze9
aan9
weglot8
init8
wij7
voor7
met7
06
after6
u6
snippet6
element5
fonds5
zijn5
links5
content5
add5
ons5
inherit5
wg-element-wrapper4
functione4
volledig4
langforeachlink4
event4
listener4
linkaddeventlistenerclick4
fondsen4
prevent4
default4
epreventdefault4
switch4
settimeout4
settimeoutweglotswitchtothisgetattributelang1604
te4
documentqueryselectorallwg-element-wrappersw14
documentqueryselectorwg-element-wrappersw14
each4
weglotoninitialized4
14
langcurrentlangclick4
all4
text4
auto4
apikey4
weglotinitialize4
get4
const4
langcurrentlang4
ifdocumentqueryselectorwg-element-wrappersw14
exists4
if4
weglotgetcurrentlang4
currentlang4
ik3
vaneck3
bestevaer3
processen3
capital3
binnen3
bij3
color3
fondsbeheerders3
aanpak3
display3
23
styles3
hun3
kunnen3
width3
height3
background3
filter3
cloud3
uw3
wg62d9b9b0750831f48721322c8384946b63
fund3

Who hosts Enabl.solutions?

Enabl.solutions Hosting Provider Information

Hosted IP Address:192.0.78.194
Hosted Hostname:192.0.78.194
Service Provider:AUTOMATTIC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:openresty

Is "AUTOMATTIC" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
AUTOMATTIC
0.5447%

HTTP Header Analysis for Enabl.solutions

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Mon, 15 Nov 2021 18:30:15 GMT
Content-Type: text/html
Content-Length: 13733
Connection: keep-alive
Content-Encoding: gzip
x-lambda-id: 2e0bc98b-d3e6-4540-b08f-0f4cbde09113
Via: 1.1 varnish, 1.1 varnish
Accept-Ranges: bytes
Age: 0
X-Served-By: cache-dca17766-DCA, cache-dub4347-DUB
X-Cache: MISS, MISS
X-Cache-Hits: 0, 0
X-Timer: S1637001015.989024,VS0,VE937
Vary: Accept-Encoding
X-Cluster-Name: eu-west-1-prod-eks-15

Enabl.solutions Domain Nameserver Information

HostIP AddressCountry
ns3.wordpress.com 192.0.74.9
ns2.wordpress.com 198.181.117.9
ns1.wordpress.com 198.181.116.9


Need to find out who hosts Enabl.solutions?


Domain Registration (WhoIs) information for Enabl.solutions

 Domain Name: enabl.solutions
Registry Domain ID: eabd834e89e64943a48c8675adc732bd-DONUTS
Registrar WHOIS Server: whois.sawbuck.com
Registrar URL: http://www.wordpress.com
Updated Date: 2021-10-18T10:11:36Z
Creation Date: 2019-11-12T19:56:07Z
Registry Expiry Date: 2022-11-12T19:56:07Z
Registrar: Automattic Inc.
Registrar IANA ID: 1531
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8772733049
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Not specified
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province:
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: NL
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns2.wordpress.com
Name Server: ns1.wordpress.com
Name Server: ns3.wordpress.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-11-15T18:30:16Z

Websites with Similar Names

Enabl.one
Home – Enabl
Enabl.plus
Enabl home page
Enabl.solutions
AssetCare | Home
Enabl3d.com
The domain name Enabl3d.com is for sale
Enabldsecurity.com
404 - Page Not Found
Enable-3d.com
ENABLE 3D

Recently Updated Websites

Aoavip724.vip (5 seconds ago.)Daydaydate.com (6 seconds ago.)Claras-cravings.com (7 seconds ago.)Cchangecounseling.com (12 seconds ago.)Chez-noble.com (16 seconds ago.)Ayudaincometaxservices.com (18 seconds ago.)Emrahautoantalya.com (21 seconds ago.)Theowlslair.com (30 seconds ago.)Erniedurbin.com (31 seconds ago.)Franckavitabile.com (32 seconds ago.)Riskeconomics.us (33 seconds ago.)Auslots.com (35 seconds ago.)Greatneckjumbomortgagerate.com (40 seconds ago.)Bfcsmartmoney.com (41 seconds ago.)Healingourcoreissuesinstitute.com (42 seconds ago.)Jpbfc.com (44 seconds ago.)Yibobet1972.com (47 seconds ago.)Goodsrightnow.com (48 seconds ago.)Ladydogsreport.com (51 seconds ago.)Chimineasinc.com (51 seconds ago.)Druhakuze.com (1 minute ago.)Agussuparno.com (1 minute 1 second ago.)Caravanparks.scot (1 minute 1 second ago.)Codeacross.com (1 minute 3 seconds ago.)Eberhard-autoteile.de (1 minute 6 seconds ago.)Sloganrun.com (1 minute 10 seconds ago.)Tideinteractive.com (1 minute 12 seconds ago.)Crazymadcustoms.com (1 minute 15 seconds ago.)Myonetruehomevalue.com (1 minute 15 seconds ago.)Jb-picturestone.com (1 minute 16 seconds ago.)

Recently Searched Keywords

0 background (1 second ago.)cadenas de acero (3 seconds ago.)jati padang, pasar minggu, south jakarta city, special capital region of jakarta, indonesia (7 seconds ago.)https: bucket-prod-01.s3.eu-west-1.amazonaws.com uploads content 703d12bd3044725df6c4527a409c3a81 talent image f5b5fea5c434c9d745a32c979ab133e9 4 4 44660[00-99]-original.jpeg (8 seconds ago.)japanese nurse sex japanese massage sex japanese (9 seconds ago.)calc350px 0px (14 seconds ago.)dinneuzeitgroteskltw01-812426sans-seriftext-decoration comp-j7k3t8r0 pro-galleryinline-styles (17 seconds ago.)концерт фалмис и приятели - 2020 (23 seconds ago.)bts bdzie si (26 seconds ago.)trip types (26 seconds ago.)приемники (oem модули) (27 seconds ago.)here 362500 add (31 seconds ago.)installateur de climatisation aix en provence (34 seconds ago.)rotate0deg -ms-transform rotate0deg (36 seconds ago.)transcendental meditation (43 seconds ago.)vacation rental (43 seconds ago.)приворот на крови самостоятельно возможно ли сделать (46 seconds ago.)gtgtnbsp (57 seconds ago.)散热器 (58 seconds ago.)abri, garage, carport et rangement (58 seconds ago.)calendrier lunaire octobre 2020 cheveux (59 seconds ago.)place assisted (1 minute ago.)du dysfonctionnement (1 minute ago.)5. märz 2021 (1 minute 1 second ago.)台风“美莎克”将给中国东部及北部海域带来大浪和风暴潮 (1 minute 2 seconds ago.)lucknow (1 minute 2 seconds ago.)facebook google other (1 minute 3 seconds ago.)cardiac diabetic pharma pcd franchise company for andhra pradesh (1 minute 3 seconds ago.)td-post-category transform translate-50 (1 minute 5 seconds ago.)2019-04-23 (1 minute 5 seconds ago.)