Enablers – Become a Successful Entrepreneur with Pakistan Most Advanced Training Courses

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: 38,211
Estimated Worth: $398,160
Category: This site has not been categorized yet



Domain summary

Last updated
2021-06-29
Domain label
enablers
Domain extension
org
Domain registered:
2016-08-21
Domain updated:
2021-06-29
Global Traffic Rank
38,211
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$398,160
Estimated daily income
$553
Estimated monthly income
$16,820

Frequently Asked Questions (FAQ)

Q: When was Enablers.org registered?
A: Enablers.org was registered 5 years, 3 months, 1 week, 5 days, 16 hours, 43 minutes, 41 seconds ago on Sunday, August 21, 2016.
Q: When was the WHOIS for Enablers.org last updated?
A: The WHOIS entry was last updated 5 months, 3 days, 16 hours, 43 minutes, 41 seconds ago on Tuesday, June 29, 2021.
Q: What are Enablers.org's nameservers?
A: DNS for Enablers.org is provided by the following nameservers:
  • ns2.inmotionhosting.com
  • ns1.inmotionhosting.com
Q: Who is the registrar for the Enablers.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Enablers.org?
A: Enablers.org ranks 38,211 globally on Alexa. Enablers.org has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Enablers.org each day?
A: Enablers.org receives approximately 46,060 visitors and 276,360 page impressions per day.
Q: What IP address does Enablers.org resolve to?
A: Enablers.org resolves to the IPv4 address .
Q: In what country are Enablers.org servers located in?
A: Enablers.org has servers located in the .
Q: What webserver software does Enablers.org use?
A: Enablers.org is powered by Nginx/1.21.0 webserver.
Q: Who hosts Enablers.org?
A: Enablers.org is hosted by Unknown in .
Q: How much is Enablers.org worth?
A: Enablers.org has an estimated worth of $398,160. An average daily income of approximately $553, which is roughly $16,820 per month.

Enablers.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Enablers.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Enablers.org

H1 Headings

0 :

H2 Headings

23 :
  1. WORLD-CLASS PERFORMANCE SERVICES
  2. ENABLERS SELLERS DASHBOARD
  3. HERE IS WHAT WE OFFER
  4. AMAZON ACCOUNTMANAGEMENT
  5. AMAZON SELLERSDASHBOARD
  6. AMAZON 1:1COACHING
  7. AMAZON PRIVATE LABEL BOOT CAMP
  8. VATRAINING
  9. ENABLINGVIDEO SERIES
  10. Learn more Skills,Advance your Career
  11. MOMENTS TO BE REMEMBERED
  12. WE PARTNER, CREATE AND ENABLEBRANDS TO GROW
  13. Huzi Malik
  14. Nabeel Ashraf
  15. Imran Raza
  16. Imran Afzal
  17. Abdul Basit
  18. Huzi Malik
  19. Naseem Naseer
  20. UPCOMING SEMINAR SCHEDULE
  21. ENTER THE FOLD
  22. GET LATEST TIPS FROM INDUSTRY EXPERTS
  23. Contact Us

H3 Headings

1 :
  1. OUR FRIENDS

H4 Headings

3 :
  1. Sialkot
  2. Lahore
  3. Islamabad

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

66 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-156663066-1

Links - Internal

72:

Links - Internal (nofollow)

0:

Links - Outbound

5:

Links - Outbound (nofollow)

0:

Keyword Cloud for Enablers.org

ambassador of pakistanbestmanyallpeopleampreadmalikrankleadyou dontlearn morelahoreservicessuccesssellers0officeslead ambassadoritems 1islamabadread moreinformativetruelearn more amazonnewamoneseminarsveryitemsmarketplaceamazonvery informativeyetmoreseriesyou dont needtrainingsourmore amazonteamlearnsuccess storiesstorieshavedont needyourweambassadortrainingdocumentwriteneedsessionamazingdontbutpakistanmrenablingenablersyoubusiness

Who hosts Enablers.org?

Enablers.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx/1.21.0

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%

HTTP Header Analysis for Enablers.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.21.0
Date: Tue, 29 Jun 2021 01:13:57 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 34530
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
X-UA-Compatible: IE=edge
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
X-Proxy-Cache: MISS

Enablers.org Domain Nameserver Information

HostIP AddressCountry
ns2.inmotionhosting.com 70.39.150.2
ns1.inmotionhosting.com 74.124.210.242


Need to find out who hosts Enablers.org?


Domain Registration (WhoIs) information for Enablers.org

 Domain Name: ENABLERS.ORG
Registry Domain ID: D189679946-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-04-01T08:04:44Z
Creation Date: 2016-08-21T14:30:18Z
Registry Expiry Date: 2021-08-21T14:30:18Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: The Strategic Insight
Registrant State/Province: Washington
Registrant Country: US
Name Server: NS2.INMOTIONHOSTING.COM
Name Server: NS1.INMOTIONHOSTING.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-06-29T01:12:58Z

Websites with Similar Names

Enabl.one
Home – Enabl
Enabl.plus
Enabl home page
Enabl.solutions
AssetCare | Home
Enabl3d.com
The domain name Enabl3d.com is for sale
Enabldsecurity.com
404 - Page Not Found
Enable-3d.com
ENABLE 3D Halter für Werkzeuge I WIESEMANN 1893

Recently Updated Websites

Maisonbatignolles.com (8 seconds ago.)Sabbanh.com (8 seconds ago.)Avonizatuvida.com (11 seconds ago.)Beposity.com (12 seconds ago.)Ucieventcenter.com (14 seconds ago.)Lesarcades-letouquet.ovh (14 seconds ago.)Planetswim.org (16 seconds ago.)Sierravistaphotos.com (19 seconds ago.)7837814.com (22 seconds ago.)Winaliterus.ru (23 seconds ago.)Ten-eleven-nine.com (25 seconds ago.)Reptibug.com (26 seconds ago.)Maslisboa.com (27 seconds ago.)Perfectsolutionsone.com (27 seconds ago.)Niemann-technik.com (29 seconds ago.)Indiaatnet.com (33 seconds ago.)Stressheadacheareas.com (38 seconds ago.)Pointpleasanthvacservice.com (41 seconds ago.)Thyro-helth.info (43 seconds ago.)Incopia.net (44 seconds ago.)Esplins.com.au (45 seconds ago.)Art-buket.kz (46 seconds ago.)Conceptspros.com (49 seconds ago.)Bazardelalitterature.com (49 seconds ago.)Beachunters.com (51 seconds ago.)Rightlawyerrighttime.com (54 seconds ago.)Huashengdai.com (55 seconds ago.)Shopmajordodge.com (58 seconds ago.)Estudioavarq.com (58 seconds ago.)Face-buff.com (1 minute 1 second ago.)

Recently Searched Keywords

inggrisnbspyapromosinbsp100 welcome bonus (1 second ago.)toners benefits (1 second ago.)oralb-gh-shop (2 seconds ago.)aktuality 252 (2 seconds ago.)title-link field date (2 seconds ago.)roll-upy (2 seconds ago.)sberbank banja luka (2 seconds ago.)05kg 837780000 (3 seconds ago.)znbspnadrukiem (4 seconds ago.)правосудие (4 seconds ago.)tech to empower (4 seconds ago.)universidad euro hispanoamericana (6 seconds ago.)urlsi (6 seconds ago.)scrap zoom (6 seconds ago.)color rgb90 90 (7 seconds ago.)zoom showing failed to detect microphone (8 seconds ago.)р р°р·рір»рµс‡рµрѕрёсџ (8 seconds ago.)følg (9 seconds ago.)dziki rozwizaniu (10 seconds ago.)vacation packing list – everything you don’t forget read more » (11 seconds ago.)0.0我的狐仙女友 sp 03! (11 seconds ago.)prawn (12 seconds ago.)comp-knt9si1m pcomp-knt9si1m h1comp-knt9si1m (12 seconds ago.)ti ph250 (12 seconds ago.)09:50karolina gets kinky in the sun (14 seconds ago.)anna akana (15 seconds ago.)rozwijamy talenty (15 seconds ago.)кондиціонери (15 seconds ago.)beauty tips fitness (15 seconds ago.)padding-left 36px (16 seconds ago.)