Encoresystems.net  |  Encore Systems eCommerce web site development, PayPal Website Payments Pro, PayPal Adaptive Payments
Low trust score  | 
Encore Systems develops eCommerce sites and web applications. Encore Systems sells a .NET SDK for PayPal. Encore Systems specializes in affordable web design, small business web design, eCommerce web design, web site development, eCommerce development, PayPal Website Payments Pro, PayPal Adaptive Payments, PayPal web service, application develop...

Encoresystems.net Website Information

Website Ranks & Scores for Encoresystems.net

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:2,938,005
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:21%
DMOZ DMOZ Listing:No

Whois information for encoresystems.net

Full Whois Lookup for Encoresystems.net Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Encoresystems.net. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: 142202693_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.1and1.com
Registrar URL: http://registrar.1and1.info
Updated Date: 2016-05-11T05:27:23Z
Creation Date: 2005-02-11T00:50:18Z
Registry Expiry Date: 2018-02-11T00:50:18Z
Registrar: 1&1 Internet SE
Registrar IANA ID: 83
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6105601459
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS-US.1AND1-DNS.COM
Name Server: NS-US.1AND1-DNS.DE
Name Server: NS-US.1AND1-DNS.ORG
Name Server: NS-US.1AND1-DNS.US
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-03T12:04:09Z

Who hosts Encoresystems.net?

Encoresystems.net is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218.
Encoresystems.net has an IP Address of and a hostname of and runs Microsoft-IIS/8.5 web server.

Encoresystems.net Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4889
Location Longitude:-98.3987
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Encoresystems.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Microsoft-IIS/8.5
Vary: Accept-Encoding
X-AspNet-Version: 2.0.50727
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Date: Tue, 15 Dec 2015 09:02:36 GMT
Connection: Keep-Alive
X-Powered-By: ASP.NET
Content-Length: 5577

Need to find out who hosts Encoresystems.net?

Encoresystems.net Free SEO Report

Website Inpage Analysis for Encoresystems.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Encoresystems.net

ecommercemicrosoftsystemsdatapaymentserviceswetierpaypalcustompayment services

Longtail Keyword Density for Encoresystems.net

payment services3

What are the nameservers for encoresystems.net?

Encoresystems.net Domain Nameserver Information

HostIP AddressCountry
dns1.stabletransit.com States United States
dns2.stabletransit.com States United States

Encoresystems.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Encoresystems.net is a scam?