Enfordnewsletter.org Website Analysis Summary

Enfordnewsletter.org  |  Enford Newsletter - Home Page
Low trust score  | 

Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Enfordnewsletter.org has a Low Trust Score, and a Statvoo Rank of I.

Enfordnewsletter.org is hosted by Unified Layer in Utah, Provo, United States, 84606.
Enfordnewsletter.org has an IP Address of and a hostname of host359.hostmonster.com.

The domain enfordnewsletter.org was registered 201 decades 9 years 3 months ago by , it was last modified 201 decades 9 years 3 months ago and currently is set to expire 201 decades 9 years 3 months ago.

Enfordnewsletter.org has a total of 0 backlinks.

Enfordnewsletter.org gets approximately 0 unique visitors a day and 0 pageviews per day.

Enfordnewsletter.org has an estimated worth of $9.
An average daily income of approximately $0, which is wroughly $0 per month.

Whois information for enfordnewsletter.org

Full Whois Lookup for Enfordnewsletter.org Whois Lookup

Registry Domain ID: D155181590-LROR
Registrar WHOIS Server:
Registrar URL: http://www.fastdomain.com
Updated Date: 2016-12-29T10:35:51Z
Creation Date: 2009-01-24T19:07:22Z
Registry Expiry Date: 2018-01-24T19:07:22Z
Registrar Registration Expiration Date:
Registrar: FastDomain Inc.
Registrar IANA ID: 1154
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C57360625-LROR
Registrant Name: Steve Becker
Registrant Organization: Enford Newsletter
Registrant Street: 12 Coombe Lane
Registrant City: Enford
Registrant State/Province:
Registrant Postal Code: SN9 6DF
Registrant Country: GB
Registrant Phone: +44.1980670345
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C57360625-LROR
Admin Name: Steve Becker
Admin Organization: Enford Newsletter
Admin Street: 12 Coombe Lane
Admin City: Enford
Admin State/Province:
Admin Postal Code: SN9 6DF
Admin Country: GB
Admin Phone: +44.1980670345
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C22986508-LROR
Tech Name: Hostmonster Inc
Tech Organization: Hostmonster.com
Tech Street: 1958 S 950 E
Tech City: Provo
Tech State/Province: Utah
Tech Postal Code: 84606
Tech Country: US
Tech Phone: +1.8014948462
Tech Phone Ext:
Tech Fax: +1.8017651992
Tech Fax Ext:
Tech Email: Login to show email
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-28T22:48:25Z

Who hosts Enfordnewsletter.org?

Enfordnewsletter.org Web Server Information

Hosted IP Address:
Hosted Hostname:host359.hostmonster.com
Service Provider:Unified Layer
Hosted Country:United StatesUS
Location Latitude:40.2181
Location Longitude:-111.6133
Webserver Software:Not Applicable

HTTP Header Analysis for Enfordnewsletter.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 21 Dec 2015 16:40:43 GMT
Server: Apache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 3760
Content-Type: text/html

Need to find out who hosts Enfordnewsletter.org?

Enfordnewsletter.org Free SEO Report

Website Inpage Analysis for Enfordnewsletter.org

H1 Headings:1
H2 Headings:1
H3 Headings:1
H4 Headings:1
H5 Headings:1
H6 Headings:1
Total IFRAMEs:0
Total Images:8
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Enfordnewsletter.org

followhaveiflinknewslettervillageany0agmlatestpleaseparish councilhalleventssathereinformationplanyouenfordminutesvillage hallenford villagereadparishcouncil

Longtail Keyword Density for Enfordnewsletter.org

village hall8
enford village3
parish council3

What are the nameservers for enfordnewsletter.org?

Enfordnewsletter.org Domain Nameserver Information

HostIP AddressCountry
ns1.hostmonster.com States United States
ns2.hostmonster.com States United States

Enfordnewsletter.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Enfordnewsletter.org is a scam?