Palmknihy - e-knihy ve vaší dlani

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: Unknown
Estimated Worth: $9



Domain summary

Last updated
2021-04-16
Domain label
ereading
Domain extension
cz
Domain registered:
2010-03-05
Domain updated:
2014-06-24
Domain expires:
2022-03-05
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is ereading.cz ranked relative to other sites:

Percentage of visits to ereading.cz from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ereading.cz registered?
A: Ereading.cz was registered 11 years, 1 month, 1 week, 5 days, 4 hours, 43 minutes, 13 seconds ago on Friday, March 5, 2010.
Q: When was the WHOIS for Ereading.cz last updated?
A: The WHOIS entry was last updated 6 years, 9 months, 3 weeks, 2 days, 4 hours, 43 minutes, 13 seconds ago on Tuesday, June 24, 2014.
Q: What are Ereading.cz's nameservers?
A: DNS for Ereading.cz is provided by the following nameservers:
  • alfa.ns.active24.cz
  • beta.ns.active24.cz
  • gama.ns.active24.sk
Q: Who is the registrar for the Ereading.cz domain?
A: The domain has been registered at CZ-NIC.
Q: What is the traffic rank for Ereading.cz?
A: Ereading.cz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ereading.cz each day?
A: Ereading.cz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ereading.cz resolve to?
A: Ereading.cz resolves to the IPv4 address 185.219.171.92.
Q: In what country are Ereading.cz servers located in?
A: Ereading.cz has servers located in the Czech Republic.
Q: What webserver software does Ereading.cz use?
A: Ereading.cz is powered by Nginx/1.10.3 webserver.
Q: Who hosts Ereading.cz?
A: Ereading.cz is hosted by Fara Negar Pardaz Khuzestan in Czechia.
Q: How much is Ereading.cz worth?
A: Ereading.cz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Ereading.cz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ereading.cz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Ereading.cz

H1 Headings

2 :
  1. E-knihy: Bestsellery
  2. Výběry

H2 Headings

5 :
  1. Přihlášení
  2. Registrace
  3. Doporučujeme
  4. E-knihy: Novinky
  5. Akce, slevy

H3 Headings

33 :
  1. Zapomněli jste heslo?
  2. Přihlašovací informace
  3. Osobní informace
  4. Drzý kravaťák
  5. Listopád
  6. Idol
  7. Vzdorující královna
  8. Dokonalý zločin
  9. Takový hněv
  10. PŘEDPRODEJ: Miluju tě. Já vím
  11. Zpověď bratra Haluina
  12. Čtvrteční klub amatérských…
  13. Takový hněv
  14. Listopád
  15. Bridgertonovi: Vévoda a já
  16. Selah – nebojácna princezná
  17. Město bez války
  18. Světla nad močálem
  19. Dům polámaných andělů
  20. Matematika pro život
  21. Dokud mě nenajdou
  22. PŘEDPRODEJ: Miluju tě. Já vím
  23. Propustka na svobodu
  24. Vražedný rozsudek
  25. Vražedná lhůta
  26. Nevítaný host
  27. Navždycky
  28. Dubnové e-knižní novinky
  29. Cena Jiřího Ortena: Nominace…
  30. PŘEDPRODEJ: Miluju tě. Já vím
  31. Magnesia Litera – Nominace…
  32. PŘEDPRODEJ: Listopád
  33. Loňský ročník Magnesia Litera

H4 Headings

26 :
  1. Penelope Ward,
  2. Vi Keeland
  3. Alena Mornštajn…
  4. Kristen Callihan
  5. Meghan March
  6. Helen Fieldsová
  7. Cara Hunterová
  8. Nofreeuse…
  9. Ellis Peters
  10. Richard Osman
  11. Cara Hunterová
  12. Alena Mornštajn…
  13. Julia Quinnová
  14. Anna Bright
  15. Světlana Ponomarev…,
  16. Nikolaj Ponomarev
  17. Lucie Ortega
  18. Luis Alberto…
  19. Kit Yates
  20. Jo Jakeman
  21. Nofreeuse…
  22. Ken Follett
  23. Andreas Gruber
  24. Andreas Gruber
  25. Shari Lapena
  26. Nofreeuse…

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

54 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

206:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

6:

Keyword Cloud for Ereading.cz

k xeb51akceclientdecision consenttext false249 k xeb51xe7bf 229jconsenttext falseaudioknihyxe7bf 249 kdetailywindowresizefunction if windowwidthcookiesadult229 kdtsk literatura199 k xeb51contain true prevnextbuttonspoddocumentreadyfunction if windowwidthscifi romantika erotikaekniha novdetektivky fantasyifepreventdefaultvs zajmheightnejvcesvtovprevnextbuttons falsexe7bf 1182freescroll true containfunction eprevnextbuttons false pagedotszajm novinky5varpalmknihyfunction ifxe7bfscifi romantikafalse elsesxe7bf 118 kheslotrue contain trueelse windowresizefunctionclientdecision consenttextostrovywindowwidth 1210flickityviewportattrstylewidth100heigtsearcheknihaeskrozvoj1kategorie eskpagedots falsetest4zobrazitnbspveeknihyfantasydetektivky fantasy scifithrilleryfreescroll truescifielse flickityviewportattrstylewidth100 ifhorory krimi detektivkythrillery hororydocumentreadyfunctionromantika erotikaprevnextbuttonsosobn rozvojsefalse pagedots falsenewnovinkydetektivky249 kromantikaelse flickityviewportattrstylewidth100true prevnextbuttonstrue containosobnwindowresizefunction ifelsefalse pagedotswindowwidth 1210 flickityviewportattrstylewidth100nov xe7bf 22930 xe7bftrue prevnextbuttons falsenofreeusefantasy scifithrillery horory krimijakvspagedots false elsewindowwidth70nov xe7bf3left freescrollfalsenovinky bestselleryslevyleft freescroll truekrimi detektivkypagedots8bannersizenovelse windowresizefunction ifcellalignfantasy scifi romantikakategoriehororypalmknihchvechnyclientdecisionkrimi detektivky fantasyekniha xe7bfna palmknihchkkrimicellalign leftconsenttextnejvce vs zajmvmfreescrollregistraceliteratura229 k xeb51nejvce vsifwindowwidthflickityviewportattrstylewidth100 ifsouhlasm118 k xeb51contain truexe7bf 229 kbestselleryzajm novinky bestselleryxe7bf 199if windowwidth 1210containekniha 30left1210 flickityviewportattrstylewidth100false else windowresizefunctiondtskcellalign left freescrollrepublikahorory krimiliteratura faktuxe7bf 199 ke6template9if windowwidththisattrdataidcxeb51199 kfaktuerotikazajmvs zajm novinkyekniha nov xe7bfwindowresizefunction118 kxe7bf 249trueproekniha 30 xe7bfelse ifwindowwidthnadocumentreadyfunction iffunctionzobrazitnbspve ekniha

Longtail Keyword Density for Ereading.cz

KeywordsOccurences
left freescroll true8
if windowwidth 12108
prevnextbuttons false pagedots8
true prevnextbuttons false8
contain true prevnextbuttons8
true contain true8
freescroll true contain8
cellalign left freescroll8
false pagedots false8
e-kniha nov xe7bf8
229 k xeb515
e-kniha -30 xe7bf5
xe7bf 229 k5
windowresizefunction if windowwidth4
else windowresizefunction if4
pagedots false else4
documentreadyfunction if windowwidth4
else flickity-viewportattrstylewidth100 if4
windowwidth 1210 flickity-viewportattrstylewidth1004
false else windowresizefunction4
xe7bf 118 k3
118 k xeb513
xe7bf 199 k3
199 k xeb513
nov xe7bf 2293
nejvce vs zajm3
vs zajm novinky3
249 k xeb513
xe7bf 249 k3
sci-fi romantika erotika3
fantasy sci-fi romantika3
detektivky fantasy sci-fi3
krimi detektivky fantasy3
horory krimi detektivky3
thrillery horory krimi3
zajm novinky bestsellery3
clientdecision consenttext false3
k xeb5124
nov xe7bf10
e-kniha xe7bf9
if windowwidth9
true contain8
pagedots false8
freescroll true8
left freescroll8
cellalign left8
windowwidth 12108
true prevnextbuttons8
prevnextbuttons false8
e-kniha nov8
contain true8
false pagedots8
e-kniha -307
documentreadyfunction if6
xe7bf 2295
-30 xe7bf5
229 k5
else windowresizefunction4
function if4
1210 flickity-viewportattrstylewidth1004
function e4
false else4
flickity-viewportattrstylewidth100 if4
zobrazitnbspve e-kniha4
else flickity-viewportattrstylewidth1004
windowresizefunction if4
118 k3
199 k3
xe7bf 1183
else ifwindowwidth3
clientdecision consenttext3
xe7bf 1993
na palmknihch3
249 k3
horory krimi3
nejvce vs3
vs zajm3
zajm novinky3
novinky bestsellery3
kategorie esk3
thrillery horory3
krimi detektivky3
xe7bf 2493
detektivky fantasy3
fantasy sci-fi3
sci-fi romantika3
romantika erotika3
dtsk literatura3
osobn rozvoj3
literatura faktu3
consenttext false3
if30
k27
xe7bf24
xeb5124
e-kniha24
true22
function21
false20
else18
var15
windowwidth11
documentreadyfunction11
nov10
literatura9
na9
prevnextbuttons8
08
flickity-viewportattrstylewidth1008
cellalign8
left8
contain8
freescroll8
pagedots8
se8
17
ifwindowwidth6
26
e-knihy6
35
novinky5
souhlasm5
45
pro5
republika4
54
zobrazitnbspve4
clientdecision4
windowresizefunction4
jak4
detaily4
height4
test4
consenttext4
osobn4
adult4
bestsellery4
s4
vs4
heslo4
new4
heigtsearch4
e4
63
epreventdefault3
registrace3
vm3
73
j3
nofreeuse3
zajm3
pod3
cookies3
palmknihch3
bannersize3
template3
nejvce3
dtsk3
erotika3
detektivky3
rozvoj3
faktu3
audioknihy3
thisattrdata-idc3
romantika3
sci-fi3
ostrovy3
fantasy3
krimi3
akce3
83
horory3
thrillery3
svtov3
esk3
93
kategorie3
vechny3
slevy3
palmknihy3

Who hosts Ereading.cz?

Ereading.cz Hosting Provider Information

Hosted IP Address:185.219.171.92
Hosted Hostname:proxy.palmknihy-ereading.cz
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:Czech RepublicCZ
Location Latitude:50.0848
Location Longitude:14.4112
Webserver Software:nginx/1.10.3

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%

HTTP Header Analysis for Ereading.cz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.3
Date: Fri, 16 Apr 2021 19:23:03 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 20559
Connection: keep-alive
X-Powered-By: Nette Framework
X-Frame-Options: SAMEORIGIN
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: X-Requested-With,Accept-Encoding
Content-Encoding: gzip
Strict-Transport-Security: max-age=31536000;

Ereading.cz Domain Nameserver Information

HostIP AddressCountry
alfa.ns.active24.cz 81.95.96.2
beta.ns.active24.cz 81.0.238.27
gama.ns.active24.sk 93.188.1.228


Need to find out who hosts Ereading.cz?


Domain Registration (WhoIs) information for Ereading.cz

 % (c) 2006-2021 CZ.NIC, z.s.p.o.
%
% Intended use of supplied data and information
%
% Data contained in the domain name register, as well as information
% supplied through public information services of CZ.NIC association,
% are appointed only for purposes connected with Internet network
% administration and operation, or for the purpose of legal or other
% similar proceedings, in process as regards a matter connected
% particularly with holding and using a concrete domain name.
%
% Full text available at:
% http://www.nic.cz/page/306/intended-use-of-supplied-data-and-information/
%
% See also a search service at http://www.nic.cz/whois/
%
%
% Whoisd Server Version: 3.12.2
% Timestamp: Fri Apr 16 19:23:03 2021

domain: ereading.cz
registrant: ALBATROSMEDIA
admin-c: AM_IT_SVARC
nsset: NSS:GLOBE-SGLO000001:1
keyset: A24-KEYSET
registrar: REG-ACTIVE24
registered: 05.03.2010 11:18:35
changed: 24.06.2014 20:25:27
expire: 05.03.2022

contact: ALBATROSMEDIA
org: Albatros Media a.s.
name: Albatros Media a.s.
address: Na Pankráci 30/1618
address: Praha 4
address: 140 00
address: CZ
registrar: REG-ACTIVE24
created: 13.09.2011 16:46:12
changed: 15.05.2018 21:32:00

contact: AM_IT_SVARC
org: Albatros Media a.s.
name: Stanislav Švarc
address: Na Pankráci 30/1618
address: Praha 4
address: 140 00
address: Česká republika
address: CZ
registrar: REG-ACTIVE24
created: 13.09.2011 16:56:12
changed: 09.04.2015 21:58:35

nsset: NSS:GLOBE-SGLO000001:1
nserver: beta.ns.active24.cz (81.0.238.27, 2001:1528:151::12)
nserver: gama.ns.active24.sk
nserver: alfa.ns.active24.cz (81.95.96.2, 2a02:4a8:ac24:100::96:2)
tech-c: ACTIVE24
registrar: REG-ACTIVE24
created: 01.10.2007 02:00:00
changed: 19.07.2011 15:27:33

contact: ACTIVE24
org: ACTIVE 24, s.r.o.
name: ACTIVE 24, s.r.o.
address: Sokolovská 394/17
address: Praha 8
address: 186 00
address: CZ
registrar: REG-ACTIVE24
created: 29.04.2008 12:35:02
changed: 15.05.2018 21:32:00

keyset: A24-KEYSET
dnskey: 257 3 13 0EK9ChwJW+CVCvP7mizQwEnR2OJpHgbLmilGV5OyqncZoOufo9fIbVrvxT6qid/T9sAWH7KOfzItPxkVOIbRjg==
tech-c: ACTIVE24
registrar: REG-ACTIVE24
created: 26.11.2008 14:12:02
changed: 10.09.2019 15:48:38

Websites with Similar Names

Eread-ebooks.com
eread-ebooks.com - Registered at Namecheap.com
Eread.bg
eRead.bg | ВСИЧКО ЗА ЕЛЕКТРОННИТЕ КНИГИ
Eread.com
403 - Forbidden: Access is denied.
Eread.com.au
Advant Plus
Eread.download
eread.download - Registered at Namecheap.com
Eread.info
Новый сайт успешно создан и готов к работе
Eread.sinaapp.com
Welcome to CodeIgniter
Eread.tech
eread.tech - Registered at Namecheap.com
Eread.xyz
eread.xyz | 502: Bad gateway

Recently Updated Websites

Angkorwatdaytours.com (1 second ago.)Authormanjuhoward.com (2 seconds ago.)Prateekdigital.com (2 seconds ago.)Backstein.net (2 seconds ago.)Ameriacademy.com (2 seconds ago.)Apdifcolombia.com (2 seconds ago.)Threedaughtersextracts.com (3 seconds ago.)Delvalbankruptcy.com (3 seconds ago.)Virtualtrivianights.com (3 seconds ago.)Seasonedinseattle.com (4 seconds ago.)Heavenboundcrematory.com (4 seconds ago.)Mustikasakti.com (4 seconds ago.)Janrephotocart.com (5 seconds ago.)Moultondomesticservicesltd.com (5 seconds ago.)Edenparkpeds.com (5 seconds ago.)Cofrashop.com (5 seconds ago.)Atlantis.mk (5 seconds ago.)Tidyyourtime.com (6 seconds ago.)Gulmargsnowexperts.com (6 seconds ago.)Ussafedate.com (7 seconds ago.)Laserbodysculpting.ca (7 seconds ago.)Scaleworksproductions.com (7 seconds ago.)Chickyduck.com (7 seconds ago.)Amadorcrafts.com (8 seconds ago.)Bonitaesterorealestate.com (8 seconds ago.)Foxys.org (8 seconds ago.)Bostonbeancoldbrew.com (9 seconds ago.)Fhzpg.com (9 seconds ago.)Oshpz.cyou (9 seconds ago.)Luteranie.pl (9 seconds ago.)

Recently Searched Keywords

level-2 (1 second ago.)生活智慧王 (2 seconds ago.)hair accessories (3 seconds ago.)下载送28 (3 seconds ago.)new ceo and ambitious expansion plan (4 seconds ago.)netshop isp cyprus (10 seconds ago.)sunday tea with mae west (11 seconds ago.)animation-new from transform (11 seconds ago.)2020in news amp (12 seconds ago.)arcade (15 seconds ago.)style-kcw6q9tmicon (16 seconds ago.)td-block-titlebefore content (18 seconds ago.)3. bug for you! (21 seconds ago.)komisja edukacji, kultury i sportu (22 seconds ago.)mini literatur-karteien (25 seconds ago.)buchführung und jahresabschlusserstellung nach hgb - klausurtraining (28 seconds ago.)edemeyeceiniz (31 seconds ago.)2014年8月 (32 seconds ago.)vicente (33 seconds ago.)old school gangbang reloaded (33 seconds ago.)szxingyuan (34 seconds ago.)8221 8220 (34 seconds ago.)空天獵 (35 seconds ago.)march 28 2018 (36 seconds ago.)stock options form (36 seconds ago.)qabar ka azab (37 seconds ago.)marip 13 (38 seconds ago.)getcurrentviewportsize switch (38 seconds ago.)hipaa pci-dss ssae (39 seconds ago.)alligator boat ride florida (39 seconds ago.)