Erotiktreff.tv - Unzensierte Live Action

Safety: Low trust score
Year Founded: 2007
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Erotiktreff.tv is a subdomain of Tv

Erotiktreff.tv - Unzensierte Live Action



Domain summary

Last updated
2021-09-17
Domain label
erotiktreff
Domain extension
tv
Domain registered:
2007-03-01
Domain updated:
2021-03-02
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Erotiktreff.tv registered?
A: Erotiktreff.tv was registered 14 years, 7 months, 2 weeks, 4 days, 2 hours, 27 minutes, 6 seconds ago on Thursday, March 1, 2007.
Q: When was the WHOIS for Erotiktreff.tv last updated?
A: The WHOIS entry was last updated 7 months, 2 weeks, 3 days, 2 hours, 27 minutes, 6 seconds ago on Tuesday, March 2, 2021.
Q: What are Erotiktreff.tv's nameservers?
A: DNS for Erotiktreff.tv is provided by the following nameservers:
  • ns-1007.awsdns-61.net
  • ns-1428.awsdns-50.org
  • ns-1653.awsdns-14.co.uk
  • ns-281.awsdns-35.com
Q: Who is the registrar for the Erotiktreff.tv domain?
A: The domain has been registered at 1&1 IONOS SE.
Q: What is the traffic rank for Erotiktreff.tv?
A: Erotiktreff.tv has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Erotiktreff.tv each day?
A: Erotiktreff.tv receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Erotiktreff.tv resolve to?
A: Erotiktreff.tv resolves to the IPv4 address .
Q: In what country are Erotiktreff.tv servers located in?
A: Erotiktreff.tv has servers located in the .
Q: What webserver software does Erotiktreff.tv use?
A: Erotiktreff.tv is powered by Nginx/1.18.0 webserver.
Q: Who hosts Erotiktreff.tv?
A: Erotiktreff.tv is hosted by Unknown in .
Q: How much is Erotiktreff.tv worth?
A: Erotiktreff.tv has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Erotiktreff.tv Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Erotiktreff.tv Free SEO Report

Website Inpage Analysis for Erotiktreff.tv

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

1 :
  1. Nur für Sexperten:Gewinne 30% Bonus-Coins beim Sexy QUIZ

H6 Headings

1 :
  1. Sprache ×

Total IFRAMEs

0 :

Total Images

84 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-83556732-38

Links - Internal

149:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Erotiktreff.tv

ifjsonsearchsubmit encodeuricomponentsearchtextwindowheightdebuglogtargetname targetname0 0livechatproxyaspxpseudo encodeuricomponenttargetnamedebuglogtargetnamejquerythisparentattrid langflagimgdiv2 coinsmin hd90ms 0s cubicbezier4061webkittransformsm03333 0 0content maincamslivechatproxydatastrindexoffontsize 12pt importantelse returnfontweightcookiepopbadgeimagejsonsearchsubmitpaddingtypeofcoinmin hdcubicbezier4061transitionopacity 90ms 0sencodeuricomponentsearchtext jquerygetjsonjsonurlnewtoplivecamlistdocumentlocationhref degirl encodeuricomponenttargetnamelangflagimgdivmydomainrootjsid maincamsdocumentlocationhref degirldatenschutzerklrungg debuglogtargetnameencodeuricomponenttargetname elsecookiepopmanagewrapcubicbezier0021webkittransformdataresultsettimeoutdodeferredimagesdata debuglogsearchsubmitfirsttoponline7contentreturninputattrtargetpage livechatproxy documentlocationhrefscrollpagemaincamsallsearchinitializedcollapsekeyjquerywindowresizefunctiondelayimagestimer delayimagesintervalidjquerymainnavmoremenuprepend jquerythishtmlwindowlocationhostname mydomainroot40px0 functionitemcategorymaincamsdatastrsplit0inputattrtargetpagecubicbezier4061transform 90ms 0slivecamlist content maincams debuglogtargetnamecurproduceridvar searchtextdebuglogsearchsubmit searchtextdebuglogswitching navbarinputattrtargetpage livechatproxymenutextdelayimagestimercookiepop90msvar myleftewhich 13333333 fontsizejquerythisparenthasclassdsmnonejquerydocumentreadyfunction0s cubicbezier4061webkittransformbackgroundcolor03333 0coinsmin hddebuglogaddedthisattrloadingtextjquerythisparenthasclassdsmflexnew typeerrorno methodvoncookiepopbadgetexttargetname if inputattrtargetpagerightimgloadcountermaincamswindowlocationhostname mydomainroot jsonsearchsubmit110 0 0datastrindexof 0else documentlocationhref degirlcoinminvar loadurlotherpxjquerythisparenthasclassdropdowntoggle ifvar jsonurl1090ms 0s cubicbezier4061transitionopacitymyofftopcamlabelmaincams5px12ptcoinsminimportantmethodif jquerythisparentattrid langflagimgdivif inputattrtargetpage livechatproxyif myofftopcounterurlcamlabelmaincams fontsizepagejquerythisparentattrid langflagimgdiv jquerythisparenthasclassdropdowntoggleiftypeof consolecursor pointerlivechatproxyaspxpseudo encodeuricomponenttargetname elseborderradiusletterspacing 04pxfalse loadurl addparamtourlloadurlnew typeerrornoborderstringdatatexttransformpointermywidth 5766200msfff bonuscardfooternewslinkloginhtmljquerynavbarnavmainfindnavlinkeachfunction ifif ewhich8px 0else documentlocationhrefcolor fff bonuscardmyattrif datastrindexofmycamcat ifmaxpagemaincamssearchtext jquerythisvaldatastrindexof 0 var0 loadurlnothing elselgtexttransform uppercasecookiepopbuttonsjsonsearchsubmit encodeuricomponentsearchtext jquerygetjsonjsonurlmargin 0if jquerythisparentattridmycamcat mycamcat0 padding 030pxtargetname targetnamereplacenewtargetnamecolor03333 03333 0sprache1myleftmyoffaddparamtourlloadurlfalse loadurlcenterlangflagimgdiv jquerythisparenthasclassdropdowntoggle if90ms 0s debuglogtargetname targetnamedebuglogloading livecamlistopacitye80ms 0sjquerygrpcategorymoremenuchildreneachfunction indexjquerythisparenthasclassdropdowntoggle if jquerythisparenthasclassdsmflex80mshttpscurpagemaincamsencodeuricomponenttargetname else documentlocationhref03333 033330s cubicbezier4061webkittransform 90mspositioncookiepopaccept cookiepopacceptalljquerythisaddclassoverfloweinlsencookiepoprejectmsfontweight 500new stringdatahdhd onlinejquerythisparentattridjsonurl httpsdata15pxjquerywindowwidthepreventdefault varextracoinsbonusdivtypeerrorno method namedtargetname targetnamereplacenew regexpjquerylivecamlistmaincamscssheightdata debuglogsearchsubmit searchtextif myoff13 epreventdefault0s cubicbezier4061transitionopacity 90mscurcontrolsgjquerythishtml jquerythisaddclassoverflow300ms 200msfontsize 12ptbackgroundimage8jquerygrpcategorymoremenuappend0 varlangflagimgdiv jquerythisparenthasclassdropdowntoggletransitionmethod namedcubicbezier0021transformcubicbezier4061webkittransform 90ms 0sloadurl0s cubicbezier0021webkittransformmdfontsize 12pxjquerythishtmlcubicbezier4061webkittransform 90msminwidthdebuglogtargetname targetname ifvar searchtext jquerythisvalhandlemainnavdropdown12pxscreennextpagedatastr newcamscamlabelmaincams fontsize 12ptletterspacingif mywidthtargetnamereplacenew regexpopacity 1sansserifindex if3categorydebuglogsearchsubmitfooternav ullistif jquerythisparenthasclassdnone jquerythisparenthasclassdsmnonejquerymainnavmoremenuprependsearchinitializedepreventdefault var searchtextdegirlbonuscard8pxfunctiondelayimagestimer delayimagesintervalid settimeoutdodeferredimagesmedia minwidthdoreloadcamsjsidwindowlocationhostnamecardbodyif delayimagestimercoverencodeuricomponenttargetnameewhich 13 epreventdefaultmylinkmycamcatjquerythisvalfffsearchjsonurldebuglogloadingjquerygetjsonjsonurlfunctiondata12pt importantcookiepopacceptallcubicbezier0021transitionopacitywidthcookiesbackgroundjsonurlmaxwidthtypeerrorno methodcursorelse targetname newinlinedebuglogsearchsubmit searchtext dataresultsetwindowwidthintervalidg jsonurl https windowlocationhostname0s cubicbezier4061transform 90mscofftop180ms 0sregexp gjquerythisparenthasclassdnoneif ewhich 13display inlinetrue0s cubicbezier4061transitionopacityjquerywindowheightdebuglogswitchingbonuscard cardbodyjquerythisval varcheightcubicbezier4061transitionopacity 90msewhich0s cubicbezier0021transitionopacityfalse jquerydocumentreadyfunctionjquerydocumentreadyfunction if2bonusdivbottomcolor 333333 fontsizemediasearchtext jquerythisval varfooternave ifimgloadcountermaincams 0documentlocationhrefxsmywidthhomemydomainroot jsonsearchsubmit encodeuricomponentsearchtextnavbarcookiepopdescription10pxfontfamilyregexpmaincams loadurltargetname new768pxdodeferredimagesundefinedcubicbezier4061transform 90mstrebuchetlastitemjquerynavbarnavmainprependlidebughtmlhttps windowlocationhostnamejquerythishtml elseencodeuricomponentsearchtextdisplay4jquerygetjsonjsonurl function dataif jquerythisparenthasclassdnone300msif mainnavdropdownstatetypeerrornovar myoffnewjquerywindowscrolltopsearchinitialized2dourl0s cubicbezier4061transformcubicbezier4061transformpaginationhtmlgutschein einlsenjquerygrpcategorymoremenuchildreneachfunctionbackgroundsizef4f4f4datastr new stringdatasearchcollapseexpandedelselastitem2encodeuricomponentsearchtext jquerygetjsonjsonurl functionnothingcookiepopheaderthiseachfunctionvarloadurl addparamtourlloadurlfooterdelayimagesintervalidiftypeofmydatasrcfunction data1pxnamedjquerythisparenthasclassdnone jquerythisparenthasclassdsmnonejquerythisval var jsonurliftypeof console undefined0sautoconsole undefinedtrebuchet msjquerynavbarnavmainfindnavlinkeachfunction if jquerythisparenthasclassdnone0pxregexp g padding 0newheighttextalignlivecamlist contentcoinmin hd onlinehttps windowlocationhostname mydomainrootmargin20pxsearchtextfunction nodefalseindextargetnamereplacenewgirlsvarfontsizeelse if mywidthif inputattrtargetpage0 paddingcoinsmin hd onlinemaxheightjquerycookiepopfadeout1 coinminlivechatproxy documentlocationhrefcolor ffftargetnamereplacenew regexp gmainnavdropdownstatejquerygetjsonjsonurl functionarial2 coinsmin0s cubicbezier0021transformfunction data debuglogsearchsubmitvar jsonurl httpscubicbezier4061webkittransformsearchinitialized3cookiepopsaveloadingtextdisplay nonecolor 333333jquerybtnsearchcollapsehtmlbackgroundsize coverjson90ms 0s cubicbezier4061transformdegirl encodeuricomponenttargetnamelineheightmycamcat mycamcat ifsindheighttextstatuscubicbezier4061transitionopacity0 loadurl addparamtourlloadurl180mselse if6bbe6bitemfalse varif datastrindexof 0var i 0903333scrollcontinuemaincamspasswortnewstatezindexmydomainroot jsonsearchsubmitlivechatproxy documentlocationhref livechatproxyaspxpseudoif jquerythisparenthasclassdsmflex04pxnodedo nothing elsetextalign centerscrollpageloadingmaincamsnonedocumentlocationhref livechatproxyaspxpseudo encodeuricomponenttargetname51 coinmin hdnavbar from otherjquerynavbarnavmainfindnavlinkeachfunctionnotmyscrolltopgetwidthfornavbardelayimagesintervalid settimeoutdodeferredimagesdatastrif typeoflivechatproxyaspxpseudodie13 epreventdefault varsearchtext dataresultelse targetnamecookiepopacceptdelayimagestimer trueuppercasejquerygetjsonjsonurlullistnewwidthgutscheinepreventdefaultdocumentlocationhref livechatproxyaspxpseudojquerydo nothingjquerythisparenthasclassdropdowntoggleif delayimagestimer delayimagesintervalid0 iftargetname ifnullloginconsolesetwindowwidthintervalactivetransitionduration

Longtail Keyword Density for Erotiktreff.tv

KeywordsOccurences
coinmin hd online41
1 coinmin hd41
2 coinsmin hd18
coinsmin hd online18
false loadurl addparamtourlloadurl10
0 loadurl addparamtourlloadurl8
90ms 0s cubic-bezier4061transitionopacity4
cubic-bezier4061-webkit-transform 90ms 0s4
0s cubic-bezier4061transitionopacity 90ms4
90ms 0s cubic-bezier4061-webkit-transform4
delayimagestimer delayimagesintervalid settimeoutdodeferredimages4
if delayimagestimer delayimagesintervalid4
datastr new stringdata4
cubic-bezier4061transitionopacity 90ms 0s4
90ms 0s cubic-bezier4061transform4
0s cubic-bezier4061transform 90ms4
0s cubic-bezier4061-webkit-transform 90ms4
else if mywidth4
cubic-bezier4061transform 90ms 0s4
documentlocationhref degirl encodeuricomponenttargetname3
regexp g --3
g -- debuglogtargetname3
-- debuglogtargetname targetname3
debuglogtargetname targetname if3
targetname if inputattrtargetpage3
if inputattrtargetpage livechatproxy3
inputattrtargetpage livechatproxy documentlocationhref3
livechatproxy documentlocationhref livechatproxyaspxpseudo3
documentlocationhref livechatproxyaspxpseudo encodeuricomponenttargetname3
livechatproxyaspxpseudo encodeuricomponenttargetname else3
encodeuricomponenttargetname else documentlocationhref3
else documentlocationhref degirl3
else targetname new3
targetname targetnamereplacenew regexp3
new typeerrorno method3
typeerrorno method named3
0 padding 03
color 333333 font-size3
if ewhich 133
jquerythisparenthasclassdropdown-toggle if jquerythisparenthasclassd-sm-flex3
langflagimgdiv jquerythisparenthasclassdropdown-toggle if3
jquerythisparentattrid langflagimgdiv jquerythisparenthasclassdropdown-toggle3
if jquerythisparentattrid langflagimgdiv3
if jquerythisparenthasclassd-none jquerythisparenthasclassd-sm-none3
jquerynavbar-nav-mainfindnav-linkeachfunction if jquerythisparenthasclassd-none3
navbar from other3
targetnamereplacenew regexp g3
https windowlocationhostname mydomainroot3
windowlocationhostname mydomainroot jsonsearchsubmit3
03333 0 03
mydomainroot jsonsearchsubmit encodeuricomponentsearchtext3
jsonsearchsubmit encodeuricomponentsearchtext jquerygetjsonjsonurl3
encodeuricomponentsearchtext jquerygetjsonjsonurl function3
jquerygetjsonjsonurl function data3
function data debuglogsearchsubmit3
data debuglogsearchsubmit searchtext3
debuglogsearchsubmit searchtext dataresult3
color fff bonuscard3
mycamcat mycamcat if3
camlabelmaincams font-size 12pt3
font-size 12pt important3
03333 03333 03
0 0 03
13 epreventdefault var3
jsonurl https windowlocationhostname3
var jsonurl https3
jquerythisval var jsonurl3
searchtext jquerythisval var3
do nothing else3
var searchtext jquerythisval3
var i 03
livecamlist content maincams3
epreventdefault var searchtext3
if datastrindexof 03
datastrindexof 0 var3
iftypeof console undefined3
ewhich 13 epreventdefault3
hd online60
loadurl addparamtourlloadurl54
1 coinmin41
coinmin hd41
false var20
2 coinsmin19
90ms 0s18
coinsmin hd18
0 var15
0 012
color 33333310
false loadurl10
function data9
margin 09
180ms 0s9
debuglogswitching navbar8
0 loadurl8
var jsonurl8
if mainnavdropdownstate8
targetname targetnamereplacenew7
80ms 0s7
cursor pointer6
text-transform uppercase6
font-size 12px6
300ms 200ms6
if typeof6
media min-width5
encodeuricomponenttargetname else5
color fff5
font-size 12pt5
if myoff5
false jquerydocumentreadyfunction5
padding 05
text-align center5
else if5
debuglogtargetname targetname5
targetname new5
if mywidth5
03333 033335
mywidth 5764
jsid maincams4
jquerythishtml else4
targetname if4
datastr new4
new stringdata4
imgloadcountermaincams 04
footer-nav ullist4
if delayimagestimer4
delayimagestimer delayimagesintervalid4
delayimagesintervalid settimeoutdodeferredimages4
delayimagestimer true4
do nothing4
function node4
background-size cover4
cubic-bezier4061transform 90ms4
0s cubic-bezier4061-webkit-transform4
cubic-bezier4061-webkit-transform 90ms4
0s cubic-bezier4061transitionopacity4
cubic-bezier4061transitionopacity 90ms4
0s cubic-bezier4061transform4
0s cubic-bezier0021-webkit-transform4
0s cubic-bezier0021transitionopacity4
0s cubic-bezier0021transform4
var myoff4
gutschein einlsen4
0 if3
targetnamereplacenew regexp3
inputattrtargetpage livechatproxy3
regexp g3
g --3
-- debuglogtargetname3
jquerydocumentreadyfunction if3
display none3
if inputattrtargetpage3
livechatproxy documentlocationhref3
cookiepopaccept cookiepopacceptall3
333333 font-size3
else return3
font-weight 5003
display inline3
trebuchet ms3
opacity 13
method named3
typeerrorno method3
new typeerrorno3
0 padding3
else targetname3
degirl encodeuricomponenttargetname3
documentlocationhref degirl3
else documentlocationhref3
letter-spacing 04px3
livechatproxyaspxpseudo encodeuricomponenttargetname3
documentlocationhref livechatproxyaspxpseudo3
8px 03
if jquerythisparenthasclassd-sm-flex3
console undefined3
windowlocationhostname mydomainroot3
fff bonuscard3
searchtext dataresult3
debuglogsearchsubmit searchtext3
data debuglogsearchsubmit3
jquerythisparenthasclassdropdown-toggle if3
jquerygetjsonjsonurl function3
encodeuricomponentsearchtext jquerygetjsonjsonurl3
jsonsearchsubmit encodeuricomponentsearchtext3
mydomainroot jsonsearchsubmit3
https windowlocationhostname3
jquerygrpcategorymoremenuchildreneachfunction index3
jsonurl https3
jquerythisval var3
searchtext jquerythisval3
var searchtext3
epreventdefault var3
13 epreventdefault3
ewhich 133
if ewhich3
e if3
var myleft3
bonuscard card-body3
index if3
iftypeof console3
jquerynavbar-nav-mainfindnav-linkeachfunction if3
jquerymainnavmoremenuprepend jquerythishtml3
if datastrindexof3
content maincams3
livecamlist content3
debuglogloading livecamlist3
nothing else3
maincams loadurl3
var loadurl3
0 function3
if jquerythisparenthasclassd-none3
jquerythishtml jquerythisaddclassoverflow3
jquerythisparenthasclassd-none jquerythisparenthasclassd-sm-none3
if jquerythisparentattrid3
jquerythisparentattrid langflagimgdiv3
langflagimgdiv jquerythisparenthasclassdropdown-toggle3
03333 03
12pt important3
camlabelmaincams font-size3
mycamcat if3
mycamcat mycamcat3
if myofftop3
datastrindexof 03
if122
var113
094
loadurl61
hd60
online60
addparamtourlloadurl54
151
false43
coinmin41
function36
0s36
else32
true25
new22
221
font-size20
targetname20
coinsmin19
color19
90ms18
data17
undefined17
return17
jsonurl17
jquerydocumentreadyfunction14
jquerythishtml14
myoff14
10px13
myleft13
mywidth13
padding12
media12
312
margin11
mainnavdropdownstate11
display11
typeof11
200ms10
newstate10
font-weight10
width10
delayimagestimer10
height9
jquerywindowwidth9
null9
180ms9
mycamcat9
myofftop8
background-color8
12px8
line-height8
15px8
opacity8
maincams8
item8
debuglogswitching8
033338
jquery8
e8
navbar8
max-width8
documentlocationhref8
cover7
targetnamereplacenew7
g7
jquerywindowheight7
300ms7
sm7
bonuscard7
md7
cookiepop7
lg7
80ms7
text-align7
20px7
footer7
encodeuricomponenttargetname6
46
0px6
transition6
cursor6
login6
setwindowwidthintervalactive6
newheight6
none6
iftypeof6
textstatus6
newtop6
scrollpagemaincams6
pointer6
40px6
other6
footer-nav6
uppercase6
letter-spacing6
text-transform6
searchtext6
min-width6
cookiepopsave6
delayimagesintervalid5
nextpage5
jsid5
index5
dodeferredimages5
page5
girls5
cams5
jquerywindowscrolltop5
cheight5
max-height5
die5
12pt5
sprache5
newwidth5
jquerywindowresizefunction5
px5
xs5
debuglogtargetname5
searchinitialized5
searchinitialized25
searchinitialized35
center5
z-index5
curcontrols5
position5
extracoinsbonusdiv5
fff5
auto5
thisattrloadingtext4
cubic-bezier0021-webkit-transform4
cubic-bezier0021transitionopacity4
cubic-bezier0021transform4
itemcategory4
imgloadcountermaincams4
cubic-bezier4061transitionopacity4
datastrsplit4
debughtml4
von4
cookies4
paginationhtml4
cubic-bezier4061transform4
cookiepopbadgetext4
cubic-bezier4061-webkit-transform4
counterurl4
cookiepopreject4
footer-news4
ullist4
screen4
cookiepopaccept4
node4
settimeoutdodeferredimages4
cookiepopbuttons4
right4
5px4
8px4
datastr4
1px4
stringdata4
curpagemaincams4
livecamlist4
gutschein4
lastitem4
firsttop4
background-image4
768px4
background-size4
sans-serif4
font-family4
debuglogloading4
einlsen4
mydomainroot4
mylink4
54
epreventdefault4
linkloginhtml4
nothing4
do4
langflagimgdiv4
64
jquerygetjsonjsonurlfunctiondata4
windowheight4
jquerygrpcategorymoremenuappend4
jquerycookiepopfadeout4
74
scrollpageloadingmaincams4
maxpagemaincams4
content4
json4
category4
84
important4
method4
key4
home3
jquerymainnavmoremenuprepend3
inline3
border3
cookiepopheader3
ewhich3
04px3
url3
jquerythisparenthasclassd-sm-flex3
cookiepopacceptall3
cookiepopmanagewrap3
jquerythisparenthasclassdropdown-toggle3
jquerythisval3
https3
6bbe6b3
jquerythisparenthasclassd-none3
jquerythisparentattrid3
curproducerid3
setwindowwidthintervalid3
cofftop3
not3
93
103
getwidthfornavbar3
datastrindexof3
handlemainnavdropdown3
menutext3
jquerythisparenthasclassd-sm-none3
doreloadcams3
jquerylivecamlistmaincamscssheight3
jquerynavbar-nav-mainprepend3
30px3
cookiepopbadgeimage3
bottom3
cookiepopdescription3
transition-duration3
jquerynavbar-nav-mainfindnav-linkeachfunction3
windowlocationhostname3
debuglogsearchsubmit3
jsonsearchsubmit3
all3
inputattrtargetpage3
border-radius3
--3
li3
regexp3
jquerygrpcategorymoremenuchildreneachfunction3
jquerythisaddclassoverflow3
searchjsonurl3
card-body3
camlabelmaincams3
113
lastitem23
datenschutzerklrung3
debuglogadded3
mydatasrc3
myscrolltop3
sind3
livechatproxy3
livechatproxyaspxpseudo3
encodeuricomponentsearchtext3
f4f4f43
jquerygetjsonjsonurl3
console3
dataresult3
ms3
trebuchet3
arial3
passwort3
background3
bonusdiv3
scrollcontinuemaincams3
jquerybtnsearchcollapsehtml3
searchcollapseexpanded3
named3
typeerrorno3
thiseachfunctionvar3
loadingtext3
myattr3
degirl3
searchinitializedcollapse3

Who hosts Erotiktreff.tv?

Erotiktreff.tv Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx/1.18.0

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Erotiktreff.tv

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.18.0
Date: Fri, 17 Sep 2021 17:06:10 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 135973
Connection: keep-alive
Cache-Control: private
Content-Encoding: gzip
Vary: User-Agent
X-AspNet-Version: 4.0.30319
P3P: CP="NOI CURa ADMa DEVa TAIa OUR BUS IND UNI COM NAV INT"
pics-label: (pics-1.1 "http://www.icra.org/ratingsv02.html" l gen true for "http://www.livestrip.com" r (na 1 nb 1 nc 1 nd 1 ne 1 nf 1 ng 1 nh 1 ni 1 vz 1 la 1 lb 1 lc 1 og 1 oh 1 ca 1)
X-Cache: MISS from ip-172-31-5-221
X-Cache-Lookup: MISS from ip-172-31-5-221:80
Via: 1.1 ip-172-31-5-221 (squid/3.5.20)

Erotiktreff.tv Domain Nameserver Information

HostIP AddressCountry
ns-1007.awsdns-61.net 205.251.195.239
ns-1428.awsdns-50.org 205.251.197.148
ns-1653.awsdns-14.co.uk 205.251.198.117
ns-281.awsdns-35.com 205.251.193.25


Need to find out who hosts Erotiktreff.tv?


Domain Registration (WhoIs) information for Erotiktreff.tv

 Domain Name: erotiktreff.tv
Registry Domain ID: 87298079_DOMAIN_TV-VRSN
Registrar WHOIS Server: whois.ionos.com
Registrar URL: http://ionos.com
Updated Date: 2019-11-22T11:13:09.000Z
Creation Date: 2007-03-01T14:16:19.000Z
Registrar Registration Expiration Date: 2022-03-01T14:16:19.000Z
Registrar: 1&1 IONOS SE
Registrar IANA ID: 83
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8774612631
Reseller:
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Sonalba GmbH
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province:
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: DE
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext:
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Login to show email
Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Login to show email
ns-1653.awsdns-14.co.uk
Nameserver: ns-1007.awsdns-61.net
Nameserver: ns-1428.awsdns-50.org
Nameserver: ns-281.awsdns-35.com
DNSSEC: Unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2021-09-17T17:06:10Z

Websites with Similar Names

Eroti-cart.com
Erotic Art ~ Galleries And Articles On Erotic Art
Eroti-link.com
We'll be back shortly!
Eroti-store.info
ארוטיקה יניב | חנות מין
Eroti.club
XXX Dating - Money Meets Eroticism at Eroti.Club
Eroti.com
eroti.com
Eroti.cyou
eroti.cyou is available for purchase - Sedo.com
Eroti.dk
Top 10 Sexlegetøj - Anmeldelser og Test I Spar op til 79%

Recently Updated Websites

Beeline.systems (3 seconds ago.)Soundcitydj.com (3 seconds ago.)Nysurfacerepair.com (6 seconds ago.)Makethemagichappen.com (7 seconds ago.)Bizimcity.nl (7 seconds ago.)Wagger-europe.com (8 seconds ago.)Covermysas.com (14 seconds ago.)Quardev.com (14 seconds ago.)Theunderdog.solutions (19 seconds ago.)Laserfocusdesign.com (23 seconds ago.)Melindawennermoyer.com (24 seconds ago.)Topebi.com (24 seconds ago.)Topput.site (26 seconds ago.)Graphictherapy.com (26 seconds ago.)Ashevilleglamping.info (27 seconds ago.)Steffyfirm.com (27 seconds ago.)Loexo.com (30 seconds ago.)Johncolumb.com (32 seconds ago.)Pulsetet.com (32 seconds ago.)Swich-xci.com (32 seconds ago.)Mbdesignme.com (34 seconds ago.)Jib-vid.com (35 seconds ago.)Usabykybohop.gq (35 seconds ago.)Schoerner.org (37 seconds ago.)Ohmineya.com (37 seconds ago.)Elcandilgijon.es (37 seconds ago.)Rehabilitation.com (38 seconds ago.)Touche2lumiere.com (38 seconds ago.)Letsgotoursandvacations.com (38 seconds ago.)Champagnemoment.us (39 seconds ago.)

Recently Searched Keywords

has occurred when your body (1 second ago.)domaine org (1 second ago.)best mutual funds in india for next 10 years (1 second ago.)Exact blogging.com (2 seconds ago.)10 best philippine mutual funds in 2020 (2 seconds ago.)2100 s 900 w (5 seconds ago.)0 rnrnrn (6 seconds ago.)federal bank customer care number tirur (6 seconds ago.)myo (11 seconds ago.)e hotelit (13 seconds ago.)zdarma pidat do (17 seconds ago.)911 information number (18 seconds ago.)*return to light* (chinese) (18 seconds ago.)coinmarketreader.com (19 seconds ago.)raize toyota price in india (20 seconds ago.)estateguru kokemuksia: joukkolainaamista kiinteistöihin vaihtoehdoista vakuuttavimmalla alustalla (20 seconds ago.)mayo clinics in texas (21 seconds ago.)рекламные материалы (21 seconds ago.)klantenservice (21 seconds ago.)chica china del hormiguero (24 seconds ago.)classes and add (28 seconds ago.)brayton cycle process (31 seconds ago.)hlídání dětí (31 seconds ago.)semaines ajouter au (32 seconds ago.)me armor (32 seconds ago.)father figures (33 seconds ago.)jacksonville heating and air (40 seconds ago.)stars actually made up of (43 seconds ago.)dahleen glanton (48 seconds ago.)march 11, 2021march 11, 2021 (52 seconds ago.)