Escortsindia.biz  |  Affectionate Mumbai Escorts Agency | VIP Darling | Romantic Girls Service
Low trust score  | 
I am Akshita from Mumbai, provide greater pleasure with our Mumbai escorts agency where you get charming VIP darling and lovable call girls service in Mumbai.




Escortsindia.biz Website Information

Website Ranks & Scores for Escortsindia.biz

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Whois information for escortsindia.biz

Full Whois Lookup for Escortsindia.biz Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Escortsindia.biz. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: escortsindia.biz
Registry Domain ID: DC0523882110D4E03B62DFA2E996C8F02-NSR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: whois.godaddy.com
Updated Date: 2018-09-15T06:58:49Z
Creation Date: 2018-09-10T06:58:48Z
Registry Expiry Date: 2019-09-10T06:58:48Z
Registrar: GoDaddy.com, Inc.
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: Domains By Proxy, LLC
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Arizona
Registrant Postal Code:
Registrant Country: US
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns28.domaincontrol.com
Name Server: ns27.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2018-11-03T11:09:58Z

Who hosts Escortsindia.biz?

Escortsindia.biz is hosted by in .
Escortsindia.biz has an IP Address of and a hostname of .



Escortsindia.biz Web Server Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. )

Nevada NewsMakers
- nevadanewsmakers.com

  10,919,449   $ 8.95

Ligmincha France et Suisse romande
- ligmincha.fr

  4,500,519   $ 240.00

Sexkamera-Show
- sex-cam-show.com

Auf unserer Website gibt es Frauen im Alter von mehr als 18 Jahren mit einer Reihe von sexuellen Neigungen. Wir haben verspielte Teenager und sexuelle College-Mädchen,...

  Not Applicable   $ 0.00

Live Sexcams: Gratis Live Porn Chat und Live Sex XXX Shows |...
- de.freeadultcamsonline.com

Gratis Live Sex Cam und Live Porno Chat! Größte Erwachsenen XXX Live SexCam Community, chatte mit über 700 Online Webcam Models! GRATIS! | | FreeAdultCamsOnline.com

  Not Applicable   $ 0.00

Live Sexcams: Gratis Live Porn Chat und Live Sex XXX Shows |...
- de.hot-live-sex-shows.com

Gratis Live Sex Cam und Live Porno Chat! Größte Erwachsenen XXX Live SexCam Community, chatte mit über 700 Online Webcam Models! GRATIS! | | Hot-Live-Sex-Shows.com

  Not Applicable   $ 0.00

HTTP Header Analysis for Escortsindia.biz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 03 Nov 2018 11:09:55 GMT
Server: Apache
Last-Modified: Sat, 03 Nov 2018 11:09:37 GMT
ETag: "77e0d5e-7a54-579c0b00d3c30-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 10418
Content-Type: text/html


Need to find out who hosts Escortsindia.biz?

Escortsindia.biz Free SEO Report

Website Inpage Analysis for Escortsindia.biz

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Escortsindia.biz

justnagarindependent escortservicestheylotsseerequirementclasssurelysearchholdescortsprovidepleasuregirlhaving of suchenjoyable servicebutindianlifeservice ingredientsuswouldservicejogeshwarivisitfeatureswe haveworkkinds of enjoyablerequiredservice in mumbainotbeennightprobablywonderfulmumbaichoicebeautifulcontactthesekindhiresitecall girloneescorts in mumbaiyou cangirl in mumbaimustmeetreasonfewnumeroushavingmumbai escorts19yrsourdoamongtheir servicessomepeoplecustomerscolonybestpleasecomeyoureprobably the mostmumbai callgirls escortsallhas22yrsroadsexyyoumorecustomersomethinginternationalhotkindsour escortsindependenttakeagencyfindmaymodelsmumbai independenteverymumbai call girlthanmodelindependent mumbaineverbecomeour clientstheyreselect havingcitywelltheremakealwayspossibleyour lifeeachsuch kindsbazaarsureescort girlsofferingwhichmumbai escortthosetimeyou are ableseverallikehomeescort servicethemtheirbookcall girlsproducecaneffectivelyableif1000saccordingmight select havingreason whywecustomitsgalleryheremostcategoriesone of manyselectusegivemightwanttop classenjoyableescortescorts servicesameyearsoffershillmumbai escort servicetopescort in mumbai20yrsnewreallyplacepeople mightfemalenumbercallusefulmuchwhyservice agencyclientshaveproficientwhatsappescort girlgirls in mumbaiherindividualssuchmanyingredientsshouldmight selectreadymemorablethereforeanydayindependent escortsalsoyoursovipgirlsoutfungetnakatypes

Longtail Keyword Density for Escortsindia.biz

KeywordsOccurences
escorts in mumbai20
girls in mumbai7
having of such6
kinds of enjoyable5
girl in mumbai4
mumbai escort service4
escort in mumbai4
mumbai call girl3
service in mumbai3
might select having3
you are able3
one of many3
probably the most3
escorts service15
mumbai escort12
such kinds10
mumbai escorts10
call girls9
escort service9
call girl8
escort girls6
enjoyable service6
select having5
reason why5
mumbai call5
their services4
independent escorts4
you can4
our escorts4
independent mumbai4
top class3
we have3
our clients3
girls escorts3
people might3
might select3
independent escort3
service ingredients3
your life3
mumbai independent3
service agency3
escort girl3
mumbai94
escorts64
you48
service42
escort39
our37
girls35
services29
we25
your23
call22
have20
their17
nagar17
all17
people17
many15
such15
girl14
kinds14
time14
clients13
independent13
one12
can12
most12
some12
having11
these11
agency10
enjoyable10
provide10
reason9
colony9
which9
models9
any8
select7
they7
best7
here7
but6
gallery6
them6
top6
if6
also6
therefore6
more6
city6
like6
20yrs6
find6
why6
has5
hire5
night5
wonderful5
offers5
been5
do5
get5
out5
number5
really5
might5
there5
few5
offering5
model5
22yrs4
well4
each4
every4
able4
types4
contact4
pleasure4
home4
just4
new4
individuals4
whatsapp4
take4
ready4
numerous4
please4
site4
should4
class4
youre4
hill4
vip4
hot4
life4
those3
produce3
useful3
become3
book3
surely3
categories3
19yrs3
naka3
jogeshwari3
bazaar3
road3
us3
customer3
features3
memorable3
probably3
work3
theyre3
among3
meet3
day3
fun3
much3
effectively3
so3
search3
never3
choice3
visit3
than3
want3
see3
always3
may3
custom3
make3
hold3
sexy3
beautiful3
give3
not3
customers3
proficient3
use3
international3
place3
1000s3
required3
sure3
must3
same3
kind3
possible3
would3
lots3
several3
according3
requirement3
ingredients3
her3
its3
something3
female3
years3
come3
indian3

What are the nameservers for escortsindia.biz?

Escortsindia.biz Domain Nameserver Information

HostIP AddressCountry
ns28.domaincontrol.com 173.201.71.14United States United States
ns27.domaincontrol.com 216.69.185.14United States United States

Escortsindia.biz DNS Record Analysis DNS Lookup

HostTypeTTLExtra
fffIP: f
Priority: f
Target: f
TXT: f
CPU: f
OS: f
MNAME: f
RNAME: f
Serial: f
Refresh: f
Retry: f
Expire: f
IPV6: f
MASKLEN: f
Chain: f
Weight: f
Port: f
Order: f
Pref: f
Flags: f
Services: f
REGEX: f
Replacement: f

Alexa Traffic Rank for Escortsindia.biz


Alexa Search Engine Traffic for Escortsindia.biz