Favicon Website Thumbnail
Eskisehir.Net | Eskişehir Haber - Eskişehir Son Dakika Haberleri
Low trust score
Add a review Change category Claim this site is a subdomain of Net

Eskişehir haberleri, Eskişehir yerel haberleri, Son Dakika Eskişehir haberleri, Eskişehirspor haberleri, Etkinlikler ve Eskişehir iş ilanları.

Domain summary

Domain label
Domain extension
Domain registered:
Domain updated:
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 22 years, 9 months, 2 weeks, 2 hours, 59 minutes, 53 seconds ago on Saturday, December 13, 1997.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 8 months, 3 weeks, 4 days, 2 hours, 59 minutes, 53 seconds ago on Thursday, January 2, 2020.
Q: Who is the registrar for the domain?
A: The domain has been registered at AEROTEK BILISIM SANAYI VE TICARET AS.
Q: What is the traffic rank for
A: ranks 493,613 globally on Alexa. has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit each day?
A: receives approximately 2,674 visitors and 8,022 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the Turkey.
Q: What webserver software does use?
A: is powered by LiteSpeed webserver.
Q: Who hosts
A: is hosted by Hosting Internet Hizmetleri Sanayi ve Ticaret Anonim Sirketi in Turkey.
Q: How much is worth?
A: has an estimated worth of $8,640. An average daily income of approximately $24, which is roughly $730 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Service Provider:Hosting Internet Hizmetleri Sanayi ve Ticaret Anonim Sirketi
Hosted Country:TurkeyTR
Location Latitude:41.0214
Location Longitude:28.9948
Webserver Software:LiteSpeed

Is "Hosting Internet Hizmetleri Sanayi ve Ticaret Anonim Sirketi" in the Top 10 Hosting Companies?


HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Content-Encoding: br
Vary: Accept-Encoding
Date: Wed, 23 Sep 2020 00:25:10 GMT
Server: LiteSpeed Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

WhoIs information for

Registry Domain ID: 683053_DOMAIN_NET-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2020-01-04T09:52:58Z
Creation Date: 1997-12-13T05:00:00Z
Registrar Registration Expiration Date: 2020-12-12T05:00:00Z
Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registrar IANA ID: 1534
Domain Status: clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Fatih Sezer
Registrant Organization: Fatih Sezer
Registrant Street: istiklal mh. Resadiye Sk. 41/3
Registrant City: Eskisehir
Registrant State/Province: Belirtilmemis
Registrant Postal Code: 26010
Registrant Country: TR
Registrant Phone: +90.05323875822
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: Fatih Sezer
Admin Organization: Fatih Sezer
Admin Street: istiklal mh. Resadiye Sk. 41/3
Admin City: Eskisehir
Admin State/Province: Belirtilmemis
Admin Postal Code: 26010
Admin Country: TR
Admin Phone: +90.05323875822
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: Fatih Sezer
Tech Organization: Fatih Sezer
Tech Street: istiklal mh. Resadiye Sk. 41/3
Tech City: Eskisehir
Tech State/Province: Belirtilmemis
Tech Postal Code: 26010
Tech Country: TR
Tech Phone: +90.05323875822
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Name Server:
DNSSEC: Unsigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +90.2623245555
URL of the ICANN WHOIS Data Problem Reporting System:
>>> Last update of WHOIS database: 2020-07-10T20:36:54Z Free SEO Report

Website Inpage Analysis for

H1 Headings

1 :
  1. Haber

H2 Headings

2 :
  1. Son Dakika
  2. Günün Gelişmeleri

H3 Headings

1 :
  1. Sitede Ara

H4 Headings

23 :
  1. Koronadan öldü! Tabutunu yaktılar
  2. Ceviz hırsızları yakalandı!
  3. EOSB ve İnönü Belediyesi iş birliği yapacak
  4. Canlı yayına davet etti
  5. Eskişehir'deki suç makinesi operasyonla yakalandı
  6. Es Es'ten Federasyon Başkanına ziyaret
  7. Yaralanan geyiği kurtarmak için seferber oldular
  8. Cinayet ve intihar! Yeni detaylar ortaya çıktı!
  9. Düğünler iptal olunca kınalar elde kaldı
  10. FETÖ operasyonu: 17 gözaltı
  11. Eskişehir korona virüs risk haritasında son durum
  12. Eskişehir’de sararan ilk yapraklar yere düştü
  13. Eskişehir’in kurtuluşu büyük bir coşkuyla kutlandı
  14. Eskişehir’e yakışır zafer alayı
  15. Bin 200 metre rakımdaki doğal güzellik
  16. Eskişehir korona virüs risk haritası güncellendi
  17. Eskişehir'e şehit ateşi düştü
  18. Ne Diyorsun? - Eskişehir'de Öğrenci Olmasa Ne Olur?
  19. Masaüstü - Kalabak'ta Kim Boğuldu?
  20. Eskişehir’de kadının düşme anı saniye saniye görüntülendi
  21. Han’da lavanta hasadı başladı
  22. Pandemi Döneminde Eskişehir Ekonomisi
  23. Gelişmelerden Haberdar Olun

H5 Headings

19 :
  1. Çalışkan Ekonomi Zirvesi’ni topladı
  2. 10 Üye 1 İş / Bu İddia Doğru mu ?
  3. Otomotivdeki ÖTV artışı etkisini göstermeye başladı
  4. Yangından mal kaçıran ihaleler
  5. Estetik Müdahalelerin Hukuki Niteliği ve Hekimin Sorumluluğu
  6. Dip ve zirve...
  7. Şişçi Hasan
  8. Ayasofya‘da Danıştay ne dedi ?
  9. İçinden merhametin nehri geçer bu şehrin
  10. Galeriler Tüm Galeriler
  11. Videolar Tüm Videolar
  12. Eskişehir Aile Hekimleri Derneği Başkanı Uzm. Dr. Kazım Tırpan
  13. Serdar Tomris
  14. Neslihan Çavdar
  15. Emirhan Çokaygil
  16. Batuhan Eldem
  17. Busena Çelik Zümbül
  18. Güncel Haberler
  19. Popüler Haberler

H6 Headings

63 :
  1. Bildirimler
  2. Kaydettiklerim
  3. O ilçede 23 bina karantinaya alındı
  4. Aboneliği devretmedi, 8 yıl sonra şok yaşadı
  5. Nazilerden kalma ses kaydedici ilk günkü yeniliğini koruyor
  6. Bu sesi duyan huzur buluyor
  7. Uykusuzluk bakın hangi sağlık sorunlarına neden oluyor
  8. Lara Di Lara Sazova’da sahne aldı
  9. Cihan Yıldırım
  10. Soner Yüksel
  11. Tarkan Demir
  12. Merve Akman
  13. Av. Oytun Süllü
  14. Prof. Dr. Cengiz Türe
  15. Murat Kürtül
  16. Engin Çapar
  17. Feride Turan
  18. Koronadan öldü! Tabutunu yaktılar
  19. EOSB ve İnönü Belediyesi iş birliği yapacak
  20. Canlı yayına davet etti
  21. Eskişehir'deki suç makinesi operasyonla yakalandı
  22. Es Es'ten Federasyon Başkanına ziyaret
  23. Yaralanan geyiği kurtarmak için seferber oldular
  24. Murda
  25. Khontkar
  26. Ceylan Ertem
  27. Hanım & Efendi
  28. Büyük Ev Ablukada
  29. Soner Arıca
  30. Can Bonomo
  31. Tepki
  32. Tuğkan
  33. Müebbet Muhabbet
  34. Tolga Çevik
  35. Sunay Akın ile Görçek
  36. Anıl Piyancı
  37. Şaşkın Aşıklar
  38. Kamyona çarpan motosikletin sürücüsü hayatını kaybetti
  39. Canlı yayına davet etti
  40. Eskişehir'deki suç makinesi operasyonla yakalandı
  41. Es Es'ten Federasyon Başkanına ziyaret
  42. Yolda mahsur kalan sürücünün imdadına bekçiler yetişti
  43. Eskişehir'de bıçaklı kavga: 3 yaralı
  44. Önce ayrılmak isteyen sevgilisini vurdu ardından intihar etti
  45. Eskişehir’de kaçak mazota suç üstü
  46. Kim olursa olsun kamu malına el koyamaz
  47. Metin Özöğüt Yaşam ve Bakım Merkezi’nde sona doğru
  48. Aile Hekimleri daha iyi çalışma koşulları istiyor
  49. İyi işler iyi insanlarla yapılır
  50. Genç Tecrübe: Neslihan Çavdar
  51. Genç Tecrübe: Emirhan Çokaygil
  52. Genç Tecrübe: Batuhan Eldem
  53. Marka olmak bizim elimizde
  54. Nöbetçi Eczaneler
  55. Sıkça Sorulan Sorular
  56. O ilçede 23 bina karantinaya alındı
  57. Kamyona çarpan motosikletin sürücüsü hayatını kaybetti
  58. Koronadan öldü! Tabutunu yaktılar
  59. Ceviz hırsızları yakalandı!
  60. Bakan Koca Eskişehir'in koronavirüs yoğunluk haritasını paylaştı
  61. Feci kazada ölen 2 işçinin kimlikleri belli oldu
  62. Eskişehir'de yaşayan ailenin testi pozitif çıktı
  63. Eskişehir'de Koronovirüs iddiası


0 :

Total Images

117 :

Google Adsense


Google Analytics

Not Applicable

Links - Internal

  1. No text
  4. Yazarlar
  5. İLAN
  6. Tüm Bildirimler
  7. Tüm Kaydettiklerim
  8. Ana Sayfa
  9. Röportajlar
  10. Biyografiler
  11. Video Galeri
  12. Foto Galeri
  13. Firma Rehberi
  14. Sayfalar
  15. Künye
  16. İletişim
  17. Sitene Ekle
  18. Eskişehir
  19. Eskişehirspor
  20. Politika
  21. Spor
  22. Etkinlikler
  23. Gündem
  24. Bölge Haberleri
  25. No text
  26. No text
  27. No text
  28. No text
  29. No text
  30. No text
  31. No text
  32. No text
  33. O ilçede 23 bina karantinaya alındı
  34. No text
  35. Aboneliği devretmedi, 8 yıl sonra şok yaşadı
  36. No text
  37. Nazilerden kalma ses kaydedici ilk günkü yeniliğini koruyor
  38. No text
  39. Bu sesi duyan huzur buluyor
  40. No text
  41. Koronadan öldü! Tabutunu yaktılar
  42. No text
  43. Ceviz hırsızları yakalandı!
  44. No text
  45. EOSB ve İnönü Belediyesi iş birliği yapacak
  46. No text
  47. Canlı yayına davet etti
  48. No text
  49. Eskişehir'deki suç makinesi operasyonla yakalandı
  50. No text
  51. Es Es'ten Federasyon Başkanına ziyaret
  52. No text
  53. Yaralanan geyiği kurtarmak için seferber oldular
  54. No text
  55. Cinayet ve intihar! Yeni detaylar ortaya çıktı!
  56. No text
  57. Düğünler iptal olunca kınalar elde kaldı
  58. No text
  59. FETÖ operasyonu: 17 gözaltı
  60. No text
  61. Uykusuzluk bakın hangi sağlık sorunlarına neden oluyor
  62. No text
  63. Lara Di Lara Sazova’da sahne aldı
  64. No text
  65. No text
  66. No text
  67. No text
  68. Cihan Yıldırım
  69. Çalışkan Ekonomi Zirvesi’ni topladı,431.html
  70. No text
  71. Soner Yüksel
  72. 10 Üye 1 İş / Bu İddia Doğru mu ?,434.html
  73. No text
  74. Tarkan Demir
  75. Otomotivdeki ÖTV artışı etkisini göstermeye başladı,435.html
  76. No text
  77. Merve Akman
  78. Yangından mal kaçıran ihaleler,425.html
  79. No text
  80. Av. Oytun Süllü
  81. Estetik Müdahalelerin Hukuki Niteliği ve Hekimin Sorumluluğu,270.html
  82. No text
  83. Prof. Dr. Cengiz Türe
  84. Dip ve zirve...,414.html
  85. No text
  86. Murat Kürtül
  87. Şişçi Hasan,392.html
  88. No text
  89. Engin Çapar
  90. Ayasofya‘da Danıştay ne dedi ?,372.html
  91. No text
  92. Feride Turan
  93. İçinden merhametin nehri geçer bu şehrin,415.html
  94. No text
  95. No text
  96. Tüm Galeriler
  97. No text,57.html
  98. Eskişehir korona virüs risk haritasında son durum,57.html
  99. No text,56.html
  100. Eskişehir’de sararan ilk yapraklar yere düştü,56.html
  101. No text,54.html
  102. Eskişehir’in kurtuluşu büyük bir coşkuyla kutlandı,54.html
  103. No text,53.html
  104. Eskişehir’e yakışır zafer alayı,53.html
  105. No text,52.html
  106. Bin 200 metre rakımdaki doğal güzellik,52.html
  107. No text,51.html
  108. Eskişehir korona virüs risk haritası güncellendi,51.html
  109. Tüm Videolar
  110. No text,5075.html
  111. Eskişehir'e şehit ateşi düştü,5075.html
  112. No text,5074.html
  113. Ne Diyorsun? - Eskişehir'de Öğrenci Olmasa Ne Olur?,5074.html
  114. No text,5073.html
  115. Masaüstü - Kalabak'ta Kim Boğuldu?,5073.html
  116. No text,5072.html
  117. Eskişehir’de kadının düşme anı saniye saniye görüntülendi,5072.html
  118. No text,5071.html
  119. Han’da lavanta hasadı başladı,5071.html
  120. No text,5070.html
  121. Pandemi Döneminde Eskişehir Ekonomisi,5070.html
  122. Tüm Manşetler
  123. No text
  124. Murda
  125. No text
  126. Khontkar
  127. No text
  128. Ceylan Ertem
  129. No text
  130. Hanım & Efendi
  131. No text
  132. Büyük Ev Ablukada
  133. No text
  134. Soner Arıca
  135. No text
  136. Can Bonomo
  137. No text
  138. Tepki
  139. No text
  140. Tuğkan
  141. No text
  142. Müebbet Muhabbet
  143. No text
  144. Tolga Çevik
  145. No text
  146. Sunay Akın ile Görçek
  147. No text
  148. Anıl Piyancı
  149. No text
  150. Şaşkın Aşıklar
  151. Tüm Firmalar
  152. No text
  153. Vanilla Food Coffee
  154. No text
  155. Cihannüma Çibörek
  156. No text
  157. Kahveci Saadettin
  158. No text
  159. Kurşunlu Kahvesi
  160. No text
  161. Al Banco Coffee
  162. No text
  163. Caffe De Luca
  164. No text
  165. Yosun Cafe
  166. No text
  167. Cotta Coffee
  168. No text
  169. Uçurtma Kitap ve Kafe
  170. No text
  171. Eskişehir Kitapçısı
  172. Tüm Biyografiler
  173. No text,18.html
  174. İsmail Haşim Ateş,18.html
  175. No text,17.html
  176. Recep Taşel,17.html
  177. No text,16.html
  178. Jale Nur Süllü,16.html
  179. No text,15.html
  180. Hayri Avcı,15.html
  181. No text,14.html
  182. Suat Balcı,14.html
  183. No text,12.html
  184. Harun Karacan,12.html
  185. No text
  186. Kamyona çarpan motosikletin sürücüsü hayatını kaybetti
  187. No text
  188. Yolda mahsur kalan sürücünün imdadına bekçiler yetişti
  189. No text
  190. Eskişehir'de bıçaklı kavga: 3 yaralı
  191. Önce ayrılmak isteyen sevgilisini vurdu ardından intihar etti
  192. No text
  193. Eskişehir’de kaçak mazota suç üstü
  194. No text
  195. Kim olursa olsun kamu malına el koyamaz
  196. No text
  197. Metin Özöğüt Yaşam ve Bakım Merkezi’nde sona doğru
  198. No text
  199. Eskisehir.Net | 22.09.2020 Manşeti
  200. No text
  201. Eskisehir.Net | 21.09.2020 Manşeti
  202. No text
  203. Eskisehir.Net | 18.09.2020 Manşeti
  204. No text
  205. Eskisehir.Net | 17.09.2020 Manşeti
  206. No text
  207. Eskisehir.Net | 16.09.2020 Manşeti
  208. No text
  209. Eskisehir.Net | 15.09.2020 Manşeti
  210. Tümü
  211. Eskişehir Aile Hekimleri Derneği Başkanı Uzm. Dr. Kazım Tırpan,24.html
  212. Aile Hekimleri daha iyi çalışma koşulları istiyor,24.html
  213. Serdar Tomris,23.html
  214. İyi işler iyi insanlarla yapılır,23.html
  215. Neslihan Çavdar,22.html
  216. Genç Tecrübe: Neslihan Çavdar,22.html
  217. Emirhan Çokaygil,21.html
  218. Genç Tecrübe: Emirhan Çokaygil,21.html
  219. Batuhan Eldem,20.html
  220. Genç Tecrübe: Batuhan Eldem,20.html
  221. Busena Çelik Zümbül,19.html
  222. Marka olmak bizim elimizde,19.html
  223. Tümü
  224. Nöbetçi Eczaneler
  225. Sıkça Sorulan Sorular
  226. Bakan Koca Eskişehir'in koronavirüs yoğunluk haritasını paylaştı
  227. Feci kazada ölen 2 işçinin kimlikleri belli oldu
  228. Eskişehir'de yaşayan ailenin testi pozitif çıktı
  229. Eskişehir'de Koronovirüs iddiası
  230. #Turhan Kaya
  231. #Zeynep Uyar
  232. #Mustafa Özer
  233. #Manisa
  234. #Hüsnü Arkan
  235. #Boyacıoğlu Mahallesi
  236. #Murat Mercan
  237. #Suriye
  238. #polis
  239. #Elektrik Mühendisleri Odası
  240. #hile
  241. #eskişehir
  242. #İnönü
  243. #kar yağışı
  244. #Raşit Özkan
  245. #gıda
  246. #chp
  247. #Zülfü Livaneli
  248. #otobüs
  249. #tarih
  250. RSS

Links - Internal (nofollow)

  1. No text
  2. No text
  3. No text
  4. No text
  5. No text
  6. No text
  7. No text

Links - Outbound

  1. No text
  2. No text
  3. No text
  4. No text
  5. Yazılım ve Haber Teması: TE Bilişim

Links - Outbound (nofollow)


Keyword Cloud for

federasyon bakannaeyll 2020koronadan ldeskiehir039dekiactivetabtabutunues039tenadsbygoogle windowadsbygooglecafe eskiehirettidavet ettimaneti 2020eskiehir039deki su makinesiziyaretsufederasyon bakanna ziyaretld tabutunupushcanl yaynamahallesi0makinesi operasyonla yakalandyaktlarbakannaeskiehir039detecrbegentabutunu yaktlarurladsbygoogleadsbygoogle windowadsbygoogle pushmanisaeskiehirdepush adsbygoogle windowadsbygoogleveeskimhaberlerildyaynadavettypeeskiehirmuratld tabutunu yaktlarcanl yayna davetsonneeskisehirnetcoffee cafe eskiehirsu makinesi operasyonlaes039ten federasyon bakannayayna davet ettikoronadanyayna davetes es039ten federasyoncanlcoffeemakinesi operasyonlabufederasyones039ten federasyonwindowadsbygoogle pushmaneti 2020 eskisehirnetoperasyonla yakalandeyllwindowadsbygooglemanetiyakalandkoronadan ld tabutunubirwindowadsbygoogle push adsbygooglesu makinesieskiehir039deki sucoffee cafemakinesibakanna ziyaretoperasyonlatmes es039teneskiehirsporhabercafepush adsbygoogle2020 eskisehirnetnngen tecrbeadresi

Longtail Keyword Density for

adsbygoogle windowadsbygoogle push7
maneti 2020 eskisehirnet5
windowadsbygoogle push adsbygoogle4
push adsbygoogle windowadsbygoogle4
koronadan ld tabutunu3
ld tabutunu yaktlar3
canl yayna davet3
yayna davet etti3
eskiehir039deki su makinesi3
su makinesi operasyonla3
makinesi operasyonla yakaland3
es es039ten federasyon3
es039ten federasyon bakanna3
federasyon bakanna ziyaret3
coffee cafe eskiehir3
cafe eskiehir10
adsbygoogle windowadsbygoogle7
windowadsbygoogle push7
maneti 20206
eyll 20206
2020 eskisehirnet5
push adsbygoogle4
es es039ten3
coffee cafe3
bakanna ziyaret3
federasyon bakanna3
es039ten federasyon3
makinesi operasyonla3
operasyonla yakaland3
su makinesi3
eskiehir039deki su3
davet etti3
yayna davet3
canl yayna3
tabutunu yaktlar3
ld tabutunu3
koronadan ld3
gen tecrbe3
activetab3 Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?

Websites with Similar Names -&nbspeskis Resources and Information.
Home - Eskisa S.A. Premium Park Sayfası
403 Forbidden
This site is under development
Eskişehir Escort Bayan - Bayan Escort Eskişehir İlanları
Eski?ehir Yetimo?lu Oto Kurtarma | 0544 852 28 76 - 0 536 218 77 39Yetimo?lu Oto Kurtarma Yedek Parça Oto Elektrik ve Klima Servisi

Recently Updated Websites 2 seconds 3 seconds 4 seconds 4 seconds 4 seconds 4 seconds 4 seconds 5 seconds 5 seconds 5 seconds 5 seconds 6 seconds 6 seconds 6 seconds 6 seconds 7 seconds 7 seconds 8 seconds 8 seconds 9 seconds 9 seconds 9 seconds 10 seconds 10 seconds 10 seconds 10 seconds 11 seconds 11 seconds 11 seconds 11 seconds ago.