Eso.org  |  ESO
Low trust score  | 
ESO, European Organisation for Astronomical Research in the Southern Hemisphere




Eso.org Website Information

Website Ranks & Scores for Eso.org

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:58,201
Majestic Rank Majestic Rank:3,470
Domain Authority Domain Authority:82%
DMOZ DMOZ Listing:No

Whois information for eso.org

Full Whois Lookup for Eso.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Eso.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: ESO.ORG
Registry Domain ID: D2714108-LROR
Registrar WHOIS Server:
Registrar URL: http://www.key-systems.net
Updated Date: 2015-02-26T16:55:46Z
Creation Date: 1991-02-06T05:00:00Z
Registry Expiry Date: 2023-02-07T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Key-Systems GmbH
Registrar IANA ID: 269
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C159990644-LROR
Registrant Name: Lars Lindbergh Christensen
Registrant Organization: ESO
Registrant Street: Karl Schwarzschild Str. 2
Registrant City: Garching
Registrant State/Province:
Registrant Postal Code: 85748
Registrant Country: DE
Registrant Phone: +49.89320060
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C159990644-LROR
Admin Name: Lars Lindbergh Christensen
Admin Organization: ESO
Admin Street: Karl Schwarzschild Str. 2
Admin City: Garching
Admin State/Province:
Admin Postal Code: 85748
Admin Country: DE
Admin Phone: +49.89320060
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C159990644-LROR
Tech Name: Lars Lindbergh Christensen
Tech Organization: ESO
Tech Street: Karl Schwarzschild Str. 2
Tech City: Garching
Tech State/Province:
Tech Postal Code: 85748
Tech Country: DE
Tech Phone: +49.89320060
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NIVEN.SC.ESO.ORG
Name Server: ORWELL.HQ.ESO.ORG
Name Server: LEGUIN.SC.ESO.ORG
Name Server: HQ-000-NS06.HQ.ESO.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-23T12:11:53Z

Who hosts Eso.org?

Eso.org is hosted by Verein zur Foerderung eines Deutschen Forschungsnetzes e.V. in Rheinland-pfalz, Karl, Germany, 85748.
Eso.org has an IP Address of 134.171.75.1 and a hostname of www.hq.eso.org and runs gunicorn/19.3.0 web server.



Eso.org Web Server Information

Hosted IP Address:134.171.75.1
Hosted Hostname:www.hq.eso.org
Service Provider:Verein zur Foerderung eines Deutschen Forschungsnetzes e.V.
Hosted Country:GermanyDE
Location Latitude:50.05
Location Longitude:6.8
Webserver Software:gunicorn/19.3.0

HTTP Header Analysis for Eso.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 07 Jul 2015 14:05:23 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 22818
Connection: keep-alive
Server: gunicorn/19.1.1
Content-Language: en
Content-Encoding: gzip
Vary: Cookie, Accept-Encoding
ETag: "7c537f103d505fcc52ceffd23b7b1bdc;gzip"
Access-Control-Allow-Origin: *
Access-Control-Request-Method: *


Need to find out who hosts Eso.org?

Eso.org Free SEO Report

Website Inpage Analysis for Eso.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Eso.org

futureissueopen house dayespressoorganisationreportmedia1 feb610 febscience releaseobservatoriesastronomers4544workshopphotographerscoopcontract to polishtechnologydeep18 decswissmaymusic17theirtravelblackfeb 2016signedpartnershipblack holesyoungsystemstaffclustersworlds mostpublicday event3chesneau prize24 augannouncedesos vltmarch 2015mascarasurvey telescopes815 decmountedtrip to paranalphoto6 julytimeeventsschoolgalaxyexoplanetgeneralreportsfacilitywinnersantofagastayearlaseresos very largesupermassivehouse dayjanconference1remainsoct 2016252012 2011partners24formgirls daychile anuncioremains worldssurvey telescope35gasdec 2016available 11its32may 2015nightapril 2015followconstructiontopspace scoopsecondary schoolstellarsolar systeminstrumentbursaries announcedresidencyjuly 2017light38prizesolarus2014 2013 2012awards31olivier16availableunitsolivier chesneaucluster39transferstrategic partnershipmedia advisoryuniversesurveyjune 2015productiveredsecondary school studentsjuly 2016planetopportunities in chilecamp for secondarynov 2014insightampshareastronomy campprimaryeso esoinformationschool studentseso annual reportmoststrategic2015 2014alsolistmay 2017educational232013 2012lifeschool issueeso signsbestpublic visitscontractoportunidadesoptics systemmost productive groundbased20groundbasedweekend visitsoct 2015available 1940decwinners announcedvisits paranalcapjournalhaseso astronomy camplargest43languagefunding opportunitiesdec 2015messenger no16 junecatchagreement signedviewsignsawardednowpressgirls day event710 julyobservationsvisitsstarsprimary mirrorworlds28sept 201631 marchnewsletterfoundmilkynewsimagesreceivesgermanyjan 2015garchingcontactproductive groundbased observatoryfeb 2017julyhiddenmarchbursariesawardwincamp bursariescontest now openolivier chesneau prizeeso supernovaopticsinstrumentsalma residencia51 feb 2016holesouradaptive opticsstarnovparanaloct 2014eye14eso astronomygammarayastronomyeso headquartersprize awardedwinner15longwebcamsvideossillathanvlt surveydiscoveriesarounddayomegaaug 2016productscontractsfulldomemessiersupernova29 june2017 2016jan 2017augustexhibitionannual36octgirlsnow availablelong nightscience in schoolnebulaeeso awards3dtripvideo2015 2014 2013almaeeltcompetitiontelescopefirst lightmapeventhidden treasureselectronicstageaug 2017very large telescope18 dec 201519 june 201717 oct 2016groundbased observatorychesneautelescopesagreementreleasecontestcentaurinow available 1619 june2016 nowcamp bursaries announcednebulacentre46milky wayinsight astronomy2014 2013treasuresadaptive optics systemdirector2017 2016 201527seesvery30headquarters in garchingjuly 2015very largeinsight astronomy photographereltnightscapeeso calendarprogrammecycle41advancedeso annualcalendarnaturestudentsaugust 2017now available 29proposalschileanart22house day 20162016 2015 2014ambassadorstechnology transfer9firstnov 201613everfundingavailable 29liveeso hq27 aprilvlt24esos veryastrocampopensnow available 11chillparanal observatoryvlt survey telescopenbspenglishgreen7 julyaustralia18weekeyessecondarydesignblack hole33sept 2015outreachchile17 marchopportunitiesatmosphereceremonymarch 2017septavailable 16opennow opentodayaugaofanunciohole15 juneadvisoryhqbuildspiralnew freereleasesplanetsworlds most productivevstwayorganisation releasespaceeuropeanorionanuncio de oportunidadeshaveapril 2016data2domenightscape awards11campscienceunitnoesos17 octnewthreeday 2016supermassive blackindustryindustry daywintermirrorvirtualnbspfranaisresidenciaannounced 15eso outreachmost productivepolishavailable 4june 20161metrelarge telescopenow available 4largeaprilimage42years2016 2015yourproductive groundbasedlarge telescope vltjournal37aug 2015dec 2014headquartersfebcosmicmusenbspdeutschsummerplanetariumteacherfree29siteeso remainsphoto nightscape awardsastronomy camp bursaries34profevent at eso2013 2012 2011telescope esopicturetelescope vltmeetopen housecapjournal issuesummer astrocampeducational materialnight of sciencemay 201610galaxies12observatorymaterialeso remains worldsannual reportweekendwin a tripastronomy photographer2016 now availablenov 2015eso21exoplanetshousenbspapexpostersvistaesocast19messenger26feb 2015june 2017chile chillgarching germanymarch 2016intoastronomical0photo nightscape2010 2009searchjan 2016april 2017varmerchandisesilla observatoryjunegroundbreakingadaptivecontest nowremains worlds mostcatch a star

Longtail Keyword Density for Eso.org

KeywordsOccurences
science in school13
catch a star13
open house day10
eso astronomy camp9
very large telescope6
night of science4
photo nightscape awards4
esos very large4
olivier chesneau prize4
girls day event3
event at eso3
headquarters in garching3
2016 2015 20143
trip to paranal3
productive ground-based observatory3
insight astronomy photographer3
win a trip3
now available 293
astronomy camp bursaries3
now available 43
1 feb 20163
18 dec 20153
now available 163
now available 113
camp bursaries announced3
adaptive optics system3
17 oct 20163
most productive ground-based3
worlds most productive3
contract to polish3
19 june 20173
eso annual report3
vlt survey telescope3
2015 2014 20133
large telescope vlt3
2013 2012 20113
2014 2013 20123
2016 now available3
camp for secondary3
contest now open3
eso remains worlds3
remains worlds most3
2017 2016 20153
anuncio de oportunidades3
secondary school students3
opportunities in chile3
house day 20163
now available36
march 201516
july 201713
june 201712
messenger no12
june 201512
june 201611
school issue11
open house11
march 201611
sept 201511
sept 201610
house day10
eso astronomy10
oct 201410
oct 201610
first light10
july 20159
astronomy camp9
eso supernova9
may 20178
dec 20158
july 20168
oct 20158
large telescope8
aug 20177
aug 20167
nov 20147
nov 20157
feb 20167
march 20177
agreement signed7
media advisory6
feb 20156
jan 20156
may 20156
black hole6
photo nightscape6
dec 20166
very large6
adaptive optics6
7 july5
eso signs5
aug 20155
nov 20165
april 20165
may 20165
capjournal issue5
april 20175
silla observatory4
nightscape awards4
black holes4
olivier chesneau4
31 march4
feb 20174
chesneau prize4
15 june4
eso headquarters4
jan 20174
16 june4
milky way4
dec 20144
primary mirror4
eso calendar4
long night4
organisation release4
hidden treasures4
august 20174
science release4
esos very4
alma residencia4
chile chill4
april 20154
10 july4
6 july4
19 june4
24 aug3
camp bursaries3
bursaries announced3
available 163
paranal observatory3
17 oct3
eso outreach3
visits paranal3
available 113
educational material3
optics system3
2016 20153
solar system3
2017 20163
available 293
industry day3
survey telescopes3
weekend visits3
public visits3
eso eso3
2015 20143
18 dec3
available 43
2013 20123
2012 20113
2014 20133
10 feb3
jan 20163
1 feb3
2010 20093
productive ground-based3
annual report3
eso annual3
announced 153
summer astrocamp3
2016 now3
secondary school3
funding opportunities3
telescope vlt3
school students3
telescope eso3
29 june3
esos vlt3
supermassive black3
technology transfer3
vlt survey3
survey telescope3
new free3
day 20163
strategic partnership3
chile anuncio3
eso awards3
girls day3
astronomy photographer3
insight astronomy3
ground-based observatory3
day event3
garching germany3
space scoop3
available 193
winners announced3
eso hq3
most productive3
17 march3
27 april3
prize awarded3
contest now3
now open3
worlds most3
remains worlds3
eso remains3
15 dec3
eso129
0117
1109
278
now43
telescope37
available37
june35
march34
esocast33
alma32
331
july30
science29
oct28
new28
first25
star25
astronomy23
paranal22
may21
sept21
esos20
aug19
419
open19
chile19
nov19
announced18
dec18
feb17
issue16
school16
day16
light15
elt15
515
silla14
vlt14
april14
614
winners14
714
image14
stars14
observatory13
813
catch13
jan13
visits13
913
no13
e-elt13
agreement13
messenger13
1012
prize12
1112
1212
media12
very11
telescopes11
signed11
nebula11
1311
house11
mirror11
1411
travel11
release10
camp10
universe10
1510
system10
supernova10
contract10
black10
169
179
189
199
technology9
209
219
press9
large9
229
photo9
events8
238
adaptive8
contest8
247
vst7
257
267
ever7
awards7
hidden7
years7
277
optics7
planetarium7
galaxies7
galaxy7
material7
australia7
images7
prof7
advisory6
286
outreach6
capjournal6
has6
nightscape6
news6
296
306
apex6
search6
survey6
316
construction6
ceremony6
326
most6
centre6
336
hole6
free6
346
view5
way5
videos5
residencia5
ground-based5
observations5
award5
opens5
astronomers5
students5
laser5
industry5
public5
clusters5
355
instruments5
exoplanets5
live5
planets5
365
its5
your5
signs5
polish5
375
muse5
headquarters5
annual5
products5
3d5
life5
space5
long5
cosmic5
european5
organisation5
treasures4
primary4
top4
green4
form4
awarded4
exoplanet4
contact4
site4
programme4
reports4
messier4
newsletter4
partnership4
384
us4
largest4
build4
our4
centauri4
august4
var4
winner4
vista4
fulldome4
night4
chill4
proposals4
secondary4
milky4
calendar4
holes4
solar4
picture4
planet4
cluster4
posters4
nbspdeutsch4
gas4
their4
nbspenglish4
event4
advanced4
have4
language4
art4
worlds4
general4
atmosphere4
garching4
sees4
germany4
staff4
olivier4
chesneau4
stellar4
amp4
remains3
393
weekend3
report3
bursaries3
time3
productive3
competition3
cycle3
year3
photographer3
director3
insight3
win3
trip3
map3
design3
oportunidades3
anuncio3
funding3
antofagasta3
girls3
receives3
observatories3
opportunities3
residency3
nbspfranais3
scoop3
list3
nbsp3
403
413
stage3
ambassadors3
teacher3
423
deep3
hq3
433
music3
443
journal3
conference3
virtual3
data2dome3
meet3
webcams3
winter3
educational3
1-metre3
mascara3
information3
eye3
swiss3
unit3
espresso3
units3
discoveries3
groundbreaking3
workshop3
partners3
merchandise3
gamma-ray3
mounted3
astronomical3
electronic3
exhibition3
share3
omega3
around3
spiral3
strategic3
orion3
eyes3
found3
contracts3
nebulae3
follow3
summer3
week3
chilean3
453
463
young3
three3
red3
also3
than3
best3
releases3
transfer3
future3
nature3
supermassive3
aof3
instrument3
into3
video3
today3
facility3
astrocamp3

What are the nameservers for eso.org?

Eso.org Domain Nameserver Information

HostIP AddressCountry
niven.sc.eso.org 134.171.171.15Germany Germany
orwell.hq.eso.org 134.171.42.11Germany Germany
leguin.sc.eso.org 134.171.171.16Germany Germany
hq-000-ns06.hq.eso.org 134.171.42.12Germany Germany

Eso.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Eso.org is a scam?