Espacoecriacao.com.br Favicon Espacoecriacao.com.br

Espacoecriacao.com.br Website Thumbnail
Checking...
Arquitetura | Espaço & Criação Arquitetura e Urbanismo |

Safety: Low trust score
Year Founded: 2002
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-27
Category: This site has not been categorized yet

Por meio da arquitetura corporativa e de múltiplo uso (comércio, lazer, serviços, habitação, etc...) criamos ecossistemas urbanos e arquitetônicos inovadores que criam experiências memoráveis, promovem qualidade de vida e sustentabilidade, ampliam a produtividade, a inovação e o empreendedorismo.


Domain summary

Domain label
espacoecriacao
Domain extension
com.br
Domain registered:
2002-10-08
Domain updated:
2019-04-24
Domain expires:
2024-10-08
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is espacoecriacao.com.br ranked relative to other sites:

Percentage of visits to espacoecriacao.com.br from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Espacoecriacao.com.br registered?
A: Espacoecriacao.com.br was registered 18 years, 1 month, 2 weeks, 3 days, 5 hours, 45 minutes, 49 seconds ago on Tuesday, October 8, 2002.
Q: When was the WHOIS for Espacoecriacao.com.br last updated?
A: The WHOIS entry was last updated 1 year, 7 months, 1 day, 5 hours, 45 minutes, 49 seconds ago on Wednesday, April 24, 2019.
Q: What are Espacoecriacao.com.br's nameservers?
A: DNS for Espacoecriacao.com.br is provided by the following nameservers:
  • ns12.wixdns.net
  • ns13.wixdns.net
Q: Who is the registrar for the Espacoecriacao.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Espacoecriacao.com.br?
A: Espacoecriacao.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Espacoecriacao.com.br each day?
A: Espacoecriacao.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Espacoecriacao.com.br resolve to?
A: Espacoecriacao.com.br resolves to the IPv4 address 23.236.62.147.
Q: In what country are Espacoecriacao.com.br servers located in?
A: Espacoecriacao.com.br has servers located in the United States.
Q: What webserver software does Espacoecriacao.com.br use?
A: Espacoecriacao.com.br is powered by webserver.
Q: Who hosts Espacoecriacao.com.br?
A: Espacoecriacao.com.br is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Espacoecriacao.com.br worth?
A: Espacoecriacao.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Espacoecriacao.com.br?

Espacoecriacao.com.br Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Espacoecriacao.com.br

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 27 Oct 2020 23:36:00 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.espacoecriacao.com.br/
x-wix-request-id: 1603841760.53956074233079335275
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgAmI6NXu6WfqLI/M7f8tcV,2d58ifebGbosy5xc FRalm68cz Xu5j8ot Qn6yLkv757hYrihwdSwFfXPTRcveooNc9FMS5yEcuDYlKRx MuA==,2UNV7KOq4oGjA5 PKsX47GrjRzA1MQHBBQSiu QxUjY=,m0j2EEknGIVUW/liY8BLLlbciPeodDNWNr1w8C7Wolw=,LWZ6Tylfijl32cnmU7 qjPpeQ0QOcOu3bxVsND3kCJ9YgeUJqUXtid 86vZww nL,znxyTGNb715cyF9N4jtLDI5ySgnnI52mEDDak2Uh3k/ysxQoX3el5ad7opQCDTAB
Cache-Control: no-cache
Expires: -1

Espacoecriacao.com.br Domain Nameserver Information

HostIP AddressCountry
ns12.wixdns.net 216.239.36.101
ns13.wixdns.net 216.239.38.101


Need to find out who hosts Espacoecriacao.com.br?


Domain Registration (WhoIs) information for Espacoecriacao.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-10-27T20:36:02-03:00 - IP: 165.232.37.223

domain: espacoecriacao.com.br
owner: Espaço e Criação Arquitetura Urbanismo
owner-c: FES250
tech-c: DEP4
nserver: ns12.wixdns.net
nsstat: 20201025 AA
nslastaa: 20201025
nserver: ns13.wixdns.net
nsstat: 20201025 AA
nslastaa: 20201025
created: 20021008 #988619
changed: 20190424
expires: 20241008
status: published

nic-hdl-br: FES250
person: Francisco Eduardo Gonçalves Silveira
created: 20021008
changed: 20190315

nic-hdl-br: DEP4
person: Dimitri E. Prado
created: 19980106
changed: 20140423

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, CIDR block, IP and ASN.

Espacoecriacao.com.br Free SEO Report

Website Inpage Analysis for Espacoecriacao.com.br

H1 Headings

0 :

H2 Headings

7 :
  1. O que fazemos
  2. Quem somos
  3. Nossas Criações
  4. Nossos maiores clientes
  5. Nossos números
  6. Vamos conversar

H3 Headings

0 :

H4 Headings

4 :
  1. Inúmeras
  2. 198
  3. 123506
  4. 1603

H5 Headings

0 :

H6 Headings

20 :
  1. PROJETOS
  2. MÚLTIPLO USO,
  3. URBANOS
  4. E CORPORATIVOS
  5. MAQUETES
  6. ELETRÔNICAS +
  7. RENDER AVANÇADO
  8. CONSULTORIA EM
  9. AMBIENTES DE INOVAÇÃO
  10. ADMINISTRAÇÃO
  11. E GESTÃO DE OBRAS
  12. HORAS DE BRAINSTORMING
  13. PROJETOS
  14. ENTREGUES
  15. METROS(2)
  16. CONSTRUÍDOS
  17. XÍCARAS
  18. DE CAFÉ
  19. Estamos ansiosos pelo seu contato!

Total IFRAMEs

1 :

Total Images

33 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

4:
  1. http://www.facebook.com/espacoecriacao
    http://www.facebook.com/espacoecriacao
  2. https://www.instagram.com/ec_arq_urb/
    https://www.instagram.com/ec_arq_urb/
  3. https://br.pinterest.com/espacoecriacao/
    https://br.pinterest.com/espacoecriacao/
  4. Espacoecriacao Sapiens Parque
    http://sapiensparque.com.br

Links - Outbound (nofollow)

0:

Keyword Cloud for Espacoecriacao.com.br

borderstylesolidbordercolorrgba249 24904s ease 0sarquitetura corporativa estylekec8024k1linkboxsizingborderboxbordertop12px solid255 1borderstylesolidbordercolorrgba226positionstaticboxshadow000 0b0b0b0bold10ecossistemasdesenvolvimentomarginleft calc10051 1calc100 980px 0514fontfamily1 stylejqyb1xbdnavcontainer1pxdo255 1color ffffffmaisque criamandrmargin0lineheightnormalletterspacingnormal stylekec8024sinovao de santogrossa15promovemnormal14px14emdo centroetc criamos ecossistemasborderwidth1px backgroundcolorrgba255fontnormalhabitao etcformatwoffcriam experinciasvidanbsp nbsp0selecthoverurbanosmemorveis promovem qualidadewfont9d17a94868ea729c404efe9d95544c0cf59852wf4868ea729c404efe9d95544c0origmarvelparquecomostylejqyayrlwactivestylejqyayrlwitemstylejqyayrlwlight stylejqyayrlwlink8normal normalstylejqyayrlwactivestylejqyayrlwitemstylejqyayrlwdark stylejqyayrlwlinkpositionstaticboxshadow000 0 0nampliam a produtividadecolorb3b3b3calc100 980pxborderradius0meio da arquiteturastylejqyayrlwlink stylejqyayrlwtextwrappertxtnewstylejqyb1xbdrepeaterbuttonlabeldos33 1sustentabilidade ampliamuso comrcio lazercomrcio lazer serviosmargin0vida e sustentabilidadehabitao etc criamos05s easequenovasomosborderwidth1px backgroundcolorrgba255 25504sffffffeleinovaostylekec8024k1labelwrapperdiversidadeinovao de guarapuavae ostylejqyayrlwactivestylejqyayrlwitemstylejqyayrlwdarkselectdatapreviewerrorarquitetura corporativada arquiteturaborderwidth2pxstylejqyb1xbdnavcontainerarrowstylejqyb1xbdnavcontainerrightdirectionstylekec8023sinputstrc1dataresponsivecontentstylekec8024s255 1borderstylesolidbordercolorrgba51 51daserviosborderwidth2px borderstylesolidbordercolorrgba249 249no sapiensopacity1borderwidth2px borderstylesolidbordercolorrgba24928 33nossauldirrtlstylejqyayrlwmenucontainerprodutividadefontface fontfamily28 33 1escritrionormal normal bold5ulstylekec8024sampliamtextaligncenter17px14em wfont9d17a94868ea729c404efe9d95544c0cf59852wf4868ea729c404efe9d95544c0origmarvelmetodologiacolor7a7a7asanto andrstylejqyayrlwitemcomrciosvgqualidade de vidavarinovadores que criamsedestylejtzuca32autoplayralewaysansserifarquiteturatextalignrightimportantleftauto importantzindex50corporativa ecriamos ecossistemas4positionfixedsantoformatwoff2vida eseuslesteetc criamos13204 204paddingleft0paddingright13emmarginleft0marginright05emmemorveisrgba51font normalrgba0 0 0stylejqyayrlwitem stylejqyayrlwlink stylejqyayrlwtextwrappercerti nostylekec8024s ul0sporecossistemas urbanos epmltiplo uso comrciopara1stylejqyb1xbdnavcontainerleftdirectionralewaysansserif color333333atividadespor meioe arquitetnicosulstylekec8024s olcentro1borderstylesolidbordercolorrgba51 51 51liststyletypesquarecolor333333e sustentabilidadenavegantesarquitetnicos inovadoresfontnormal normal normale arquitetnicos inovadoresnormal 14px14emstrc1inlinecontentpromovem qualidadeurbanos ecriamos ecossistemas urbanosimportanttxtnew ulselectdataerrortrue200 22014px14em ralewaysansserifboxsizingborderboxbordertop8pxstylejqyayrlwactivestylejqyayrlwitemstylejqyayrlwlightem projetosselectdatapreviewerror stylejqyb1xbdnavcontainerarrowstylejqyayrlwmenucontainer stylejqyayrlwitem stylejqyayrlwlink1backgroundcolorrgba255 255 255inovao e o249 249 1backgroundcolorrgba25516px14eme urbanismool ulcertiborderstylesolidbordercolorrgba249 249 249inovao elb1itemscontainer249 249255 255 1borderstylesolidbordercolorrgba226multiusonosso255 1borderstylesolidbordercolorrgba226 28stylejqyayrlwitem stylejqyayrlwlinkcentro de inovao980pxurbanismostylejqyayrlwtextwrapperexperinciasurbanolazer servios habitao980px 050pxselectdatapreviewhovereasecorporativaguarapuavacriam experincias memorveisfontnbspol1borderstylesolidbordercolorrgba226arquitetnicosborderstylesolidbordercolorrgba249experincias memorveisfont normal normalrgba0arquitetura e urbanismo51 51normal 17px14em wfont9d17a94868ea729c404efe9d95544c0cf59852wf4868ea729c404efe9d95544c0origmarvel1backgroundcolorrgba25512srcstylejqyb1xbdnavcontainerarrow stylejqyb1xbdnavcontainersvgcontainercriamossustentabilidadeda arquitetura corporativanormal normal 14px14emuso comrcioarquitetura efontfacecolorcorporativoborderwidth1pxoldirrtl255 255 1borderstylesolidbordercolorrgba51rgba51 51 51marginleft calc100 980pxalagoase sustentabilidade ampliamcerti no sapienscalc100espao criaostylejqyb1xbdnavcontainerarrowstylejqyb1xbdnavcontainerarrowstylejqyb1xbdnavcontainerleftdirectionsolid179 179inovadoresboxsizingborderboxbordertop12px05s ease 0sinovadores quenormal normal 17px14emergba51 51textalignleft1borderstylesolidbordercolorrgba51 511borderstylesolidbordercolorrgba226 28 33usobackgroundcolorspancriam1borderstylesolidbordercolorrgba51borderwidth2px backgroundcolorrgba255criao arquitetura estylekec8024ctextareaboxshadownoneifponta17px14em255 1 stylejqyb1xbdnavcontainerstylejqyb1xbdnavcontainersvgcontainerboxsizingborderboxbordertop8px solidbackgroundcolorrgba255 255sapiens0 0servios habitaoulpela11backgroundcolor ffffffrgba0 0249 1backgroundcolorrgba2552ul ularquitetnicos inovadores quetransitionopacity7memorveis promovemo04s easestyleikgp6es3bgseuespao criao arquiteturaprojetosstylejqyayrlwlink stylejqyayrlwsymbolmeio dacriao arquitetura255 255formatttfmltiplo usobackgroundcolorrgba25505smeioexperincias memorveis promovemstylejqyayrlwmenucontainer stylejqyayrlwitemstylejqyb1xbdnavcontainerrightdirection6positionabsolutetop0right0bottom0left0diferentesselectfocuspalmasmargin0lineheightnormalletterspacingnormalurbanos e arquitetnicosultxtnew olponta grossaqualidadeservios habitao etc133 147stylejqyayrlwlinkul liststyletypesquarenormal 17px14emmarginleft16px14em ralewaysansserifstylekec8024k1labelcomrcio lazerlazer serviosstylejqyb1xbdnavcontainercenterdirection9normal 14px14em ralewaysansserifsapiens parque05importantzindex50borderwidth2px backgroundcolorrgba255 2551backgroundcolorrgba255 255que criam experinciasstylejqyayrlwsymbolstylejqyayrlwmenucontainersejasede daambientesbackgroundcolorrgba255 255 255selectdatapreviewfocusetchabitao249 1backgroundcolorrgba255 255topautobottom0produtividade a inovao255 1borderstylesolidbordercolorrgba51inovao certilazernoecossistemas urbanosnormal boldstylejtzuca32buttonsmltiplopositionfixed importantleftautoosdase de mltiplonossosnbsp nbsp nbspultxtnewimportantleftautostylejqyb1xbdnavcontainer51 51 1normal normal normalstylejqyb1xbdnavcontainerarrowstylejqyb1xbdnavcontainercenterdirectionstylejqyayrlwlink stylejqyayrlwsymbolstylejqyayrlwmenucontainer3no sapiens parquecriaoease 0spositionfixed importantleftauto importantzindex50emfontnormal normalmargin0lineheightnormalletterspacingnormal txtnewpositionstaticboxshadow000stylejqyayrlwsymbol255 255 11borderstylesolidbordercolorrgba226 28cadaaoespao

Longtail Keyword Density for Espacoecriacao.com.br

KeywordsOccurences
calc100 980px 0564
margin-left calc100 980px64
nbsp nbsp nbsp48
background-colorrgba255 255 25515
51 51 111
font normal normal11
qualidade de vida7
centro de inovao7
arquitetura e urbanismo7
meio da arquitetura6
e arquitetnicos inovadores6
urbanos e arquitetnicos6
ecossistemas urbanos e6
criamos ecossistemas urbanos6
etc criamos ecossistemas6
normal normal bold6
habitao etc criamos6
1border-stylesolidborder-colorrgba51 51 516
da arquitetura corporativa6
arquitetura corporativa e6
e de mltiplo6
mltiplo uso comrcio6
uso comrcio lazer6
comrcio lazer servios6
arquitetnicos inovadores que6
255 1border-stylesolidborder-colorrgba51 516
servios habitao etc6
memorveis promovem qualidade6
criao arquitetura e6
espao criao arquitetura6
inovao e o6
produtividade a inovao6
ampliam a produtividade6
e sustentabilidade ampliam6
vida e sustentabilidade6
fontnormal normal normal6
lazer servios habitao6
255 255 1border-stylesolidborder-colorrgba516
experincias memorveis promovem6
criam experincias memorveis6
que criam experincias6
inovadores que criam6
border-width2px background-colorrgba255 2556
normal normal normal5
normal normal 14px14em5
style-jqyayrlwitem style-jqyayrlwlink style-jqyayrlwtext-wrapper5
04s ease 0s5
rgba0 0 04
rgba51 51 514
style-jqyayrlwmenucontainer style-jqyayrlwitem style-jqyayrlwlink4
border-width2px border-stylesolidborder-colorrgba249 2494
border-stylesolidborder-colorrgba249 249 2494
249 249 1background-colorrgba2554
249 1background-colorrgba255 2554
1background-colorrgba255 255 2554
255 255 14
255 1 style-jqyb1xbdnavcontainer4
positionstaticbox-shadow000 0 04
normal normal 17px14em4
normal 17px14em wfont9d17a94868ea729c404efe9d95544c0cf59852wf4868ea729c404efe9d95544c0origmarvel4
border-width1px background-colorrgba255 2554
255 255 1border-stylesolidborder-colorrgba2264
255 1border-stylesolidborder-colorrgba226 284
1border-stylesolidborder-colorrgba226 28 334
28 33 14
normal 14px14em ralewaysans-serif3
05s ease 0s3
no sapiens parque3
certi no sapiens3
inovao de guarapuava3
positionfixed importantleftauto importantz-index503
inovao de santo3
margin-left calc10064
calc100 980px64
980px 0564
nbsp nbsp50
normal normal24
255 25520
background-colorrgba255 25515
0 015
51 5114
font normal11
no sapiens11
51 111
ease 0s10
style-jqyayrlwitem style-jqyayrlwlink9
arquitetura e8
meio da7
fontnormal normal7
mltiplo uso7
urbanos e7
margin0line-heightnormalletter-spacingnormal txtnew7
e urbanismo7
style-jqyayrlwlink style-jqyayrlwtext-wrapper7
margin0line-heightnormalletter-spacingnormal style-kec8024s7
ralewaysans-serif color3333337
normal bold7
promovem qualidade6
vida e6
255 1border-stylesolidborder-colorrgba516
1border-stylesolidborder-colorrgba51 516
arquitetura corporativa6
memorveis promovem6
etc criamos6
que criam6
inovadores que6
arquitetnicos inovadores6
e arquitetnicos6
ecossistemas urbanos6
criamos ecossistemas6
habitao etc6
da arquitetura6
servios habitao6
lazer servios6
comrcio lazer6
uso comrcio6
corporativa e6
e sustentabilidade6
border-width2px background-colorrgba2556
criam experincias6
e o6
espao criao6
04s ease6
criao arquitetura6
experincias memorveis6
sustentabilidade ampliam6
inovao e6
ol ul6
style-jqyayrlwlink style-jqyayrlwsymbol6
1 style-jqyb1xbdnavcontainer5
style-jqyayrlwmenucontainer style-jqyayrlwitem5
sapiens parque5
normal 14px14em5
border-stylesolidborder-colorrgba249 2494
204 2044
249 2494
border-width2px border-stylesolidborder-colorrgba2494
rgba51 514
rgba0 04
249 1background-colorrgba2554
1background-colorrgba255 2554
background-color ffffff4
color ffffff4
255 14
do centro4
200 2204
txtnew ul4
certi no4
28 334
box-sizingborder-boxborder-top12px solid4
normal 17px14em4
17px14em wfont9d17a94868ea729c404efe9d95544c0cf59852wf4868ea729c404efe9d95544c0origmarvel4
border-width1px background-colorrgba2554
255 1border-stylesolidborder-colorrgba2264
1border-stylesolidborder-colorrgba226 284
33 14
style-kec8024s ul4
ul list-style-typesquare4
ul ul4
box-sizingborder-boxborder-top8px solid4
em projetos4
positionstaticbox-shadow000 04
inovao certi3
sede da3
santo andr3
font-face font-family3
por meio3
ulstyle-kec8024s ol3
05s ease3
179 1793
style-jqyayrlwactivestyle-jqyayrlwitemstyle-jqyayrlwdark style-jqyayrlwlink3
style-jqyayrlwactivestyle-jqyayrlwitemstyle-jqyayrlwlight style-jqyayrlwlink3
style-jqyayrlwlink style-jqyayrlwsymbolstyle-jqyayrlwmenucontainer3
133 1473
ultxtnew ol3
selectdata-previewerror style-jqyb1xbdnavcontainerarrow3
style-jqyb1xbdnavcontainerarrow style-jqyb1xbdnavcontainersvgcontainer3
importantleftauto importantz-index503
positionfixed importantleftauto3
14px14em ralewaysans-serif3
16px14em ralewaysans-serif3
ponta grossa3
e65
margin-left64
calc10064
980px64
0564
nbsp58
normal45
040
138
color37
background-color37
o33
inovao31
228
322
style-jqyayrlwlink21
ul20
style-kec8024s18
txtnew18
da17
que17
em17
do16
positionabsolutetop0right0bottom0left016
no16
arquitetura15
background-colorrgba25515
sapiens15
margin0line-heightnormalletter-spacingnormal14
ol14
solid14
style-jqyb1xbdnavcontainer13
ralewaysans-serif12
style-jqyayrlwmenucontainer12
ease11
border-width2px11
0s11
font11
style-jqyb1xbdnavcontainerarrow11
important11
os10
style-jqyayrlwitem10
ffffff9
meio9
projetos9
experincias9
color3333338
centro8
48
certi8
urbanos8
58
qualidade8
urbanismo7
espao7
criamos7
mltiplo7
uso7
style-jqyayrlwtext-wrapper7
parque7
sustentabilidade7
var7
vida7
fontnormal7
bold7
memorveis7
produtividade7
seja6
lazer6
ambientes6
servios6
habitao6
etc6
ecossistemas6
arquitetnicos6
66
criam6
inovadores6
rgba06
promovem6
style-kec8023sinput6
ampliam6
1border-stylesolidborder-colorrgba516
criao6
multiuso6
style-kec8024ctextarea6
comrcio6
por6
corporativa6
para6
04s6
style-jqyb1xbdnavcontainerarrowstyle-jqyb1xbdnavcontainerright-direction6
como6
style-jqyb1xbdnavcontainerarrowstyle-jqyb1xbdnavcontainerleft-direction6
style-jqyayrlwsymbol6
oldirrtl6
style-jqyb1xbdnavcontainerarrowstyle-jqyb1xbdnavcontainercenter-direction6
wfont9d17a94868ea729c404efe9d95544c0cf59852wf4868ea729c404efe9d95544c0origmarvel6
14px14em5
ulstyle-kec8024s5
guarapuava5
text-alignleft5
text-aligncenter5
das5
if5
border-radius05
75
corporativo5
ultxtnew5
escritrio4
seu4
diversidade4
pela4
nossos4
atividades4
urbano4
style-kec8024k1label4
nova4
metodologia4
box-sizingborder-boxborder-top12px4
style-kec8024k1link4
positionstaticbox-shadow0004
16px14em4
84
b0b0b04
94
rgba514
border-stylesolidborder-colorrgba2494
1background-colorrgba2554
style-kec8024k1labelwrapper4
style-jqyb1xbdrepeaterbuttonlabel4
list-style-typesquare4
padding-left0padding-right13emmargin-left0margin-right05em4
uldirrtl4
n4
box-sizingborder-boxborder-top8px4
border-width1px4
104
114
lb1itemscontainer4
0px4
1border-stylesolidborder-colorrgba2264
colorb3b3b34
17px14em4
124
desenvolvimento3
style-ikgp6es3bg3
topautobottom03
importantz-index503
importantleftauto3
positionfixed3
style-jqyb1xbdnavcontainersvgcontainer3
svg3
05s3
color7a7a7a3
palmas3
alagoas3
navegantes3
grossa3
ponta3
andr3
santo3
font-face3
selecthover3
sede3
font-family3
leste3
src3
formatwoff23
formatwoff3
formatttf3
style-jqyb1xbdnavcontainerleft-direction3
seus3
selectdata-previewhover3
style-jqyayrlwactivestyle-jqyayrlwitemstyle-jqyayrlwdark3
133
143
style-jqyayrlwsymbolstyle-jqyayrlwmenucontainer3
style-jqyayrlwactivestyle-jqyayrlwitemstyle-jqyayrlwlight3
dos3
ao3
somos3
nosso3
mais3
opacity13
margin03
transitionopacity3
style-jtzuca32buttons3
span3
p3
153
selectfocus3
ele3
style-jtzuca32autoplay3
selectdata-previewfocus3
selectdata-errortrue3
selectdata-previewerror3
style-jqyb1xbdnavcontainerright-direction3
style-jqyb1xbdnavcontainercenter-direction3
diferentes3
text-alignright3
1px3
box-shadownone3
strc1inlinecontent3
cada3
strc1data-responsive3
nossa3
content3

Espacoecriacao.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Espac-lemn-masiv.com
Espac Distributie SRL-D | Bucuresti
Espac.org
ESPAC - Working for Peace in Sudan
Espac.org.co
Escuela Parroquial de Catequistas ESPAC |
Espacam.com
espacam.com | Isimtescil.net | Ücretsiz yap?m a?amas?nda sayfas?
Espacargo.com
Welcome to ESPA Cargo
Espacaza.com
Espacaza 1976 | Caza en España y en el extranjero
Espacclineadmi.com
This site is under development

Recently Updated Websites

Simonastaburuaga.com 2 minutes 4 seconds ago.Oregonalpinechalets.com 5 minutes 11 seconds ago.Monkeymanifesto.com 10 minutes 6 seconds ago.Admin.yandex.ru 10 minutes 13 seconds ago.Onlinemahzen.com 12 minutes 45 seconds ago.Southforkrenovation.com 14 minutes 40 seconds ago.Tech4work.com 14 minutes 47 seconds ago.Lidylaw.com 14 minutes 57 seconds ago.Angelasbeautyblog.com 15 minutes 2 seconds ago.Vodopolzovatel.com 15 minutes 3 seconds ago.Bangsomenails.com 15 minutes 8 seconds ago.Reganinsurance.com 15 minutes 13 seconds ago.Cocktail-karte.de 15 minutes 16 seconds ago.Eb5-us.com 15 minutes 21 seconds ago.Rightcareindex.com 15 minutes 22 seconds ago.Ofd.hu 15 minutes 22 seconds ago.Dps-view.com 15 minutes 26 seconds ago.Chemaestro.com 15 minutes 26 seconds ago.Ateamcorp.com 15 minutes 26 seconds ago.Pussybabies.net 15 minutes 26 seconds ago.Bwxtcanada.info 15 minutes 30 seconds ago.Vaclaimsinsider.com 15 minutes 30 seconds ago.Marioscateringinc.com 15 minutes 30 seconds ago.Westleygreen.com 15 minutes 31 seconds ago.Dayumirah.com 15 minutes 31 seconds ago.Bandbexpresswi.com 15 minutes 33 seconds ago.Superclinica.com 15 minutes 33 seconds ago.Spanishstepbystep.com 15 minutes 33 seconds ago.Livingcarelifestyles.com 15 minutes 33 seconds ago.Google-study.com 15 minutes 35 seconds ago.