espoo.fi

Espoon kaupungin verkkosivut ovat paras paikka löytää tietoa kaupungin palveluista, uutisista ja tapahtumista.


Domain summary

SafetyLow trust score
Year Founded
1991
Global Traffic Rank
72,040
Estimated Worth
$209,520
Last updated
2021-05-05
Domain label
espoo
Domain extension
fi
Domain registered:
1991-01-01
Domain updated:
2020-01-08
Domain expires:
2021-08-31
Statvoo Rating
E
Estimated daily income
$291
Estimated monthly income
$8,851

Frequently Asked Questions (FAQ)

Q: When was Espoo.fi registered?
A: Espoo.fi was registered 31 years, 5 months, 3 weeks, 3 days, 7 hours, 38 minutes, 45 seconds ago on Tuesday, January 1, 1991.
Q: When was the WHOIS for Espoo.fi last updated?
A: The WHOIS entry was last updated 2 years, 5 months, 2 weeks, 3 days, 7 hours, 38 minutes, 45 seconds ago on Wednesday, January 8, 2020.
Q: What are Espoo.fi's nameservers?
A: DNS for Espoo.fi is provided by the following nameservers:
  • ns-fi.elisa.net
  • ns-se.elisa.net
Q: Who is the registrar for the Espoo.fi domain?
A: The domain has been registered at Finnish Communications Regulatory Authority.
Q: What is the traffic rank for Espoo.fi?
A: Espoo.fi ranks 72,040 globally on Alexa. Espoo.fi has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Espoo.fi each day?
A: Espoo.fi receives approximately 24,256 visitors and 145,536 page impressions per day.
Q: What IP address does Espoo.fi resolve to?
A: Espoo.fi resolves to the IPv4 address 185.50.245.166.
Q: In what country are Espoo.fi servers located in?
A: Espoo.fi has servers located in the Finland.
Q: What webserver software does Espoo.fi use?
A: Espoo.fi is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Espoo.fi?
A: Espoo.fi is hosted by City of Espoo in Uusimaa, Espoo, Finland, 02230.
Q: How much is Espoo.fi worth?
A: Espoo.fi has an estimated worth of $209,520. An average daily income of approximately $291, which is roughly $8,851 per month.

Espoo.fi Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Espoo.fi Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Espoo.fi

H1 Headings

0 :

H2 Headings

22 :
  1. Yhteystiedot
  2. Karttapalvelut
  3. Palaute
  4. Espoo.fi
  5. Helsingin seudun yhteiset palvelut, HelsinginSeutu.fi
  6. Matkailijoille, visitespoo.fi
  7. Maahanmuuttajille, infoFinland.fi
  8. Koronarokotusvuorossa tänä vuonna 50 vuotta täyttävät ja sitä vanhemmat espoolaiset sekä riskiryhmiin kuuluvat
  9. Innovaatiokilpailun osallistuja – haluatko sparrausajan?
  10. Espoon tarkastuslautakunnan arviointikertomus vuodelta 2020
  11. Suosituimmat sivut
  12. Ohjeet koronaviruksen takia
  13. Uutisia
  14. Tapahtumia
  15. Vinkkaa tapahtumasta
  16. Omatoimista liikuntaa ja ulkoliikuntapaikkoja
  17. Katujen kevätpuhdistus – vastauksia yleisimpiin kysymyksiin
  18. Koronarokotukset Espoossa
  19. Vaikuta kaupungin kehittymiseen
  20. Suurpelto I, 330404
  21. Jorvi, 630205
  22. Instagram @espooesbo

H3 Headings

7 :
  1. Kesä lähestyy - elämyksiä etänä
  2. Espoon sähköisten asiointipalvelujen uudistaminen käynnistyy
  3. ​Espoon kaupunginjohtajan innovaatiokilpailu käynnistyi
  4. Organisaatio
  5. Päätöksenteko
  6. Tietoa Espoosta
  7. Yhteystiedot

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

14 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

432:

Links - Internal (nofollow)

0:

Links - Outbound

37:

Links - Outbound (nofollow)

0:

Keyword Cloud for Espoo.fi

eventkeycode 32suositellut sis228lt246246nespoo yrityspalvelutjal228nsiuudenmaan yhteisetdocumentreadyfunctionpalvelusetelitrakentaminenif eventkeycode 13suljeliikuntaliikunta palaa takaisinsiirry suositellutkadutopetus jatakaisin edellisellebusiness espoo yrityspalvelutsulje valikkotypaikatkoulukorjaukset3ja johtokunnatvaltuusto kaupunginhallitusj228lkeengetcookieespoocookienotificationesiopetuspaikatyritt228minenyhteishakuacceptcookie getcookieespoocookienotificationinnovaatiokilpailutai sulje valikkotasolle liikuntaty246 ja yritt228minensvenskasuositellutkuntoutuskaupunginkirjastoonl228nsiuudenmaan yhteiset palvelutespoon kaupunginjohtajan innovaatiokilpailuja toimeentuloasuminen ja ymp228rist246ja vaikutakaupunginjohtajan innovaatiokilpailutilastot jasetcookiecnamevuonnakest228v228 kehitystietosuojaselosteetkloasiakaspalvelutn vuonnaja ymp228rist246ja luontoosallistu ja vaikutayhteystiedot palaavar skehittyv228ja liikenneja potilaan oikeudetorganisaatiosuositellut sis228lt246246n palaayhteiset palvelutkirjastoedelliselle tasolle kulttuurineuvottelukunnat ja neuvostotsuomiapua rekrytointiinvarhaiskasvatusp228228t246ksentekoulkoiluty246takaisin navigaatioonluontodataja tutkimuksetliikunta ja ulkoilul228nsiuudenmaanyhteytt228ja esiopetusasiakkaan ja potilaanja kaupunkikehitysja koulutustruekaupunginhallituskysytasolle varhaiskasvatusapua ty246llistymiseenvarhaiskasvatus ja esiopetusyritt228minen palaapalaa takaisin p228228tasolleturvallinendocumentcreateelementscripteventkeycodekaikkis228hk246inen ajanvarauseventkeycode 13 eventkeycodeorganisaatio ja yhteystiedotespooasukastoimintaifidosallistu jap228iv228koti jaterveysneuvontaja johtokunnat neuvottelukunnatelinkeinoespoonymp228rist246 ja luontosetcookiecname id dayskest228v228tilastotkaavoituslogotkaupunginjohtajaannafunctionyhteystiedotty246 jaedellisellepalvelutkulttuuri jayritt228minen palaa takaisinhakeminenvar acceptcookie getcookieespoocookienotificationopetushelmetfiespoon kaupungintextjavascriptlapsiperheiden palvelutkarttapalvelukysytty228if eventkeycodeosallistusosiaalilukiokoulutusasiakasmaksut ja palvelusetelitvarhaiskasvatus jafunction var acceptcookieopiskelusosiaality246 jaja yritt228minen palaapja opetuskasvatuskaupunkicarouselstillloadingohjeetbusiness espooverkossaesiopetusasioi verkossakaupunkikehitysja potilaanty246paikatpotilaan oikeudetsosiaali ja terveyspalvelutajanvarauksetsuosittelemmeja koulukorjauksetedelliselle tasolle apuailmoitusasiointipalvelurekrytointiinxmoveasiakkaan jaavoimet ty246paikatoppiva espooacceptcookiep228iv228koti ja koulukorjauksetmuutvarhaiskasvatuksessaasuminentutkimuksetneuvottelukunnatkulttuuriterveyspalvelut palaa takaisinneuvottelukunnat jaavaafunction varsuomi svenskaedelliselle tasolle asuminenespoo ty246nantajanaotauseinsekespoostavarhaiskasvatukseen1eventkeycode 13yrityksilleterveyspalvelutkuvat jaja neuvostotespoon kaupunkis228hk246inen13 eventkeycode 32valtuustoedelliselle tasolle varhaiskasvatuskaupunginjohtajanedelliselle tasolle liikuntaja terveyspalvelut palaavaikutaohjeitasiirry suositellut sis228lt246246nmediassakehittyv228 espookorkeakoulutetuillefalselapsivalikkoelinkeino ja kaupunkikehityslapsiperheidenespoon karttapalvelulomakkeetmuut palvelutovatkadut ja liikenneanna palautetta13 eventkeycodekirjastotkuvat ja logotenglishajanvaraukset verkossapalaa takaisin edellisellekuvatrejectcookieja yritt228minentasolle kulttuuriajanvarausasuminen jaespoossakartatstaiteenjohtokunnat neuvottelukunnat jataiteen perusopetusasiakasmaksut jasosiaality246p228iv228kotisvenska englishpalautettakoulutussulje valikko polkuasioisis228lt246246nsosiaality246 ja toimeentulopalaasis228lt246246n palaajohtokunnat neuvottelukunnatarkikasvatus jakulttuuri ja liikuntataikadut jajulkaisutperusopetustilastot ja tutkimuksettietosuojawilmavaravaa taiyrityspalvelutopetus ja koulutusja ulkoiluvalikko polkutasolle rakentaminentakaisindterveyspalvelut palaaty246nantajanapalaa takaisinperusopetuksenja palvelusetelitavaa tai sulje0espoon kaupunginjohtajanja liikuntaid daysja terveyspalvelutvaraustasolle apuatoimeentuloliikenneliikunta palaatai suljetakaisin p228228tasolleespootarinaperusopetuksen lomakkeetymp228rist246 javar acceptcookiepalaa takaisin navigaatioontasolle asuminenkuuluvatespookonserni kaupunginjohtajaturvallisuuskehityssuomi svenska englishfunctioneventliikunta jakaupunginkatujendayssetcookiecname idedelliselle tasolle rakentaminenp228228tasollemeihinpotilaannavigaatioonrakentamisenpalautemeihin yhteytt228hakuymp228rist246polkuajankohtaistafalse polkuavustuksettietoa espoostajohtokunnattaloustietopyynn246ttietoakaupunginosatsosiaalisessaedelliselle tasolleneuvostotasiakasmaksutty246llistymiseenyhteisettakaisin edelliselle tasollesiirryvarhaiskasvatuksenavoimetespookonsernitnespoo sosiaalisessabusinessreturnsosiaalinensis228lt246246n palaa takaisinyhteystiedot palaa takaisinapuaorganisaatio jaavoimet typaikatoppivanuorisotasolleelinkeino ja2oikeudetja yhteystiedotja logotsuurpeltousein kysytty228sosiaalisessa mediassaasiakkaansosiaali jahyvinvointiespoo sosiaalisessa mediassakasvatus ja opetusota meihinota meihin yhteytt228

Longtail Keyword Density for Espoo.fi

KeywordsOccurences
palaa takaisin edelliselle100
takaisin edelliselle tasolle100
palaa takaisin p228228tasolle14
suositellut sis228lt246246n palaa7
siirry suositellut sis228lt246246n7
palaa takaisin navigaatioon7
sis228lt246246n palaa takaisin7
ty246 ja yritt228minen6
sosiaali- ja terveyspalvelut6
asiakkaan ja potilaan5
yhteystiedot palaa takaisin5
setcookiecname id days4
if eventkeycode 134
edelliselle tasolle asuminen4
eventkeycode 13 eventkeycode4
13 eventkeycode 324
avaa tai sulje4
osallistu ja vaikuta4
edelliselle tasolle apua4
ota meihin yhteytt2284
tai sulje valikko4
sulje valikko polku4
edelliselle tasolle rakentaminen4
edelliselle tasolle varhaiskasvatus4
edelliselle tasolle kulttuuri4
terveyspalvelut palaa takaisin4
edelliselle tasolle liikunta4
liikunta ja ulkoilu3
opetus ja koulutus3
varhaiskasvatus ja esiopetus3
espoon kaupunginjohtajan innovaatiokilpailu3
function var acceptcookie3
l228nsi-uudenmaan yhteiset palvelut3
var acceptcookie getcookieespoocookienotification3
kuvat ja logot3
asiakasmaksut ja palvelusetelit3
ja potilaan oikeudet3
sosiaality246 ja toimeentulo3
ja terveyspalvelut palaa3
tilastot ja tutkimukset3
organisaatio ja yhteystiedot3
kulttuuri ja liikunta3
asuminen ja ymp228rist2463
neuvottelukunnat ja neuvostot3
johtokunnat neuvottelukunnat ja3
ja johtokunnat neuvottelukunnat3
espoo sosiaalisessa mediassa3
liikunta palaa takaisin3
elinkeino- ja kaupunkikehitys3
business espoo -yrityspalvelut3
yritt228minen palaa takaisin3
ja yritt228minen palaa3
kasvatus ja opetus3
p228iv228koti- ja koulukorjaukset3
ymp228rist246 ja luonto3
kadut ja liikenne3
suomi svenska english3
palaa takaisin121
edelliselle tasolle100
takaisin edelliselle100
takaisin p228228tasolle14
sosiaali- ja11
espoon kaupungin9
id days8
sis228lt246246n palaa7
takaisin navigaatioon7
suositellut sis228lt246246n7
siirry suositellut7
espoon karttapalvelu6
ja terveyspalvelut6
ja yritt228minen6
ty246 ja6
ja potilaan5
sosiaalisessa mediassa5
asiakkaan ja5
yhteystiedot palaa5
espoon kaupunki5
apua rekrytointiin5
tasolle asuminen4
tasolle varhaiskasvatus4
tasolle apua4
tietoa espoosta4
meihin yhteytt2284
s228hk246inen ajanvaraus4
usein kysytty2284
ota meihin4
business espoo4
tasolle rakentaminen4
suomi svenska4
ja vaikuta4
terveyspalvelut palaa4
osallistu ja4
tasolle kulttuuri4
sulje valikko4
tai sulje4
avaa tai4
eventkeycode 324
13 eventkeycode4
eventkeycode 134
yhteiset palvelut4
valikko polku4
if eventkeycode4
setcookiecname id4
tasolle liikunta4
ja logot3
kuvat ja3
ja yhteystiedot3
tilastot ja3
espoo-konserni kaupunginjohtaja3
espoon kaupunginjohtajan3
ja tutkimukset3
ja neuvostot3
var s3
acceptcookie getcookieespoocookienotification3
var acceptcookie3
function var3
tn vuonna3
kaupunginjohtajan innovaatiokilpailu3
muut palvelut3
kehittyv228 espoo3
ja esiopetus3
varhaiskasvatus ja3
ja koulutus3
opetus ja3
ja ulkoilu3
liikunta ja3
asioi verkossa3
organisaatio ja3
apua ty246llistymiseen3
neuvottelukunnat ja3
ajanvaraukset verkossa3
oppiva espoo3
taiteen perusopetus3
ja opetus3
kasvatus ja3
liikunta palaa3
ja liikunta3
kulttuuri ja3
l228nsi-uudenmaan yhteiset3
ja koulukorjaukset3
ja palvelusetelit3
asiakasmaksut ja3
potilaan oikeudet3
ja toimeentulo3
sosiaality246 ja3
lapsiperheiden palvelut3
svenska english3
p228iv228koti- ja3
perusopetuksen lomakkeet3
johtokunnat neuvottelukunnat3
espoo ty246nantajana3
ja johtokunnat3
valtuusto kaupunginhallitus3
espoo sosiaalisessa3
avoimet typaikat3
ja kaupunkikehitys3
elinkeino- ja3
espoo -yrityspalvelut3
avoimet ty246paikat3
asuminen ja3
yritt228minen palaa3
anna palautetta3
ja luonto3
ymp228rist246 ja3
kest228v228 kehitys3
ja liikenne3
kadut ja3
ja ymp228rist2463
false polku3
ja165
palaa121
takaisin121
tasolle100
edelliselle100
espoon37
espoo24
var24
yhteystiedot17
function16
palvelut16
kaupungin15
if14
p228228tasolle14
verkossa14
polku12
sosiaali-11
asuminen11
liikunta11
hakeminen10
terveyspalvelut9
kulttuuri9
ajanvaraus9
kaupunki9
julkaisut8
tietoa8
days8
id8
rakentaminen8
varhaiskasvatus8
s228hk246inen8
true8
apua8
avoimet8
ty2468
eventkeycode8
navigaatioon7
s7
l228nsi-uudenmaan7
suositellut7
sis228lt246246n7
suosittelemme7
avustukset7
siirry7
tai6
yritt228minen6
ymp228rist2466
acceptcookie6
perusopetus6
espoosta6
lomakkeet6
esiopetus6
karttapalvelu6
opetus6
sosiaalinen6
ulkoilu6
oikeudet5
potilaan5
asiakkaan5
kest228v2285
luonto5
vuonna5
rekrytointiin5
koulukorjaukset5
klo5
ohjeita5
sosiaalisessa5
mediassa5
terveysneuvonta5
vaikuta5
palvelusetelit5
svenska5
false5
p228228t246ksenteko5
varhaiskasvatuksen5
varhaiskasvatuksessa4
rejectcookie4
business4
esiopetuspaikat4
ota4
meihin4
yhteytt2284
kuntoutus4
yrityksille4
ajankohtaista4
functionevent4
sulje4
lapsi4
yhteiset4
organisaatio4
suomi4
osallistu4
varhaiskasvatukseen4
valikko4
english4
tietosuojaselosteet4
ilmoitus4
haku4
turvallinen4
varaus4
return4
korkeakoulutetuille4
espoossa4
04
14
ohjeet4
asukastoiminta4
kirjastot4
katujen4
yhteishaku4
24
setcookiecname4
koulutus4
j228lkeen4
usein4
kysytty2284
avaa4
opiskelu4
kaupunginkirjastoon4
34
d3
getcookieespoocookienotification3
kysy3
nuoriso3
asioi3
ovat3
textjavascript3
documentcreateelementscript3
stillloading3
muut3
xmove3
data3
tietopyynn246t3
tietosuoja3
documentreadyfunction3
carousel3
kaupunginjohtajan3
tn3
sek3
kuuluvat3
innovaatiokilpailu3
p3
kehittyv2283
taiteen3
suurpelto3
kaupunginosat3
liikenne3
kadut3
kaavoitus3
asiakaspalvelu3
wilma3
perusopetuksen3
p228iv228koti-3
oppiva3
lukiokoulutus3
rakentamisen3
kasvatus3
helmetfi3
kirjasto3
ajanvaraukset3
asiakasmaksut3
hyvinvointi3
toimeentulo3
sosiaality2463
lapsiperheiden3
palaute3
kehitys3
asiointipalvelu3
arki3
neuvottelukunnat3
turvallisuus3
tutkimukset3
tilastot3
logot3
kuvat3
kartat3
kaupunginjohtaja3
espoo-konserni3
talous3
neuvostot3
johtokunnat3
anna3
kaupunginhallitus3
valtuusto3
espoo-tarina3
kaikki3
typaikat3
kaupunkikehitys3
elinkeino-3
-yrityspalvelut3
ty246llistymiseen3
ty246nantajana3
ty246paikat3
palautetta3

Who hosts Espoo.fi?

Espoo.fi Hosting Provider Information

Hosted IP Address:185.50.245.166
Hosted Hostname:185.50.245.166
Service Provider:City of Espoo
Hosted Country:FinlandFI
Location Latitude:60.1499
Location Longitude:24.7569
Webserver Software:Microsoft-IIS/10.0

Is "City of Espoo" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
City of Espoo
0.0000%

HTTP Header Analysis for Espoo.fi

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/10.0
X-Frame-Options: Deny
X-XSS-Protection: 1; mode=block
Referrer-Policy: origin
Date: Wed, 05 May 2021 16:22:07 GMT
Content-Length: 57047
Strict-Transport-Security: max-age=31536000

Espoo.fi Domain Nameserver Information

HostIP AddressCountry
ns-fi.elisa.net 193.229.0.49
ns-se.elisa.net 62.248.254.2


Need to find out who hosts Espoo.fi?


Domain Registration (WhoIs) information for Espoo.fi

 domain.............: espoo.fi
status.............: Registered
created............: 1.1.1991 00:00:00
expires............: 31.8.2021 00:00:00
available..........: 30.9.2021 00:00:00
modified...........: 1.8.2020
RegistryLock.......: no

Nameservers

nserver............: ns-fi.elisa.net [OK]
nserver............: ns-se.elisa.net [OK]

DNSSEC

dnssec.............: no

Holder

name...............: Espoon kaupunki
register number....: 0101263-6
address............: PL 1
address............: 02070
address............: ESPOON KAUPUNKI
country............: Finland
phone..............: +358.468771224
holder email.......:

Registrar

registrar..........: Ascio Technologies
www................: www.ascio.com

Reseller

name...............: Elisa Oyj
email..............: Login to show email
Elisa Oyj
email..............: Login to show email
Last update of WHOIS database: 5.5.2021 19:15:05 (EET)

Websites with Similar Names

Espoo-housing.com
404 Emnte blev ikke fundet
Espoo-hr.com
Error 404 (Not Found)!!1
Espoo.be
espoo - nordic design
Espoo.com
Espoo Enterprises - Kari Jääskeläinen
Espoo.fi
espoo.fi
Espoo.online
Domain pending ICANN verification.
Espoo.tel
Directory Espoo, espoon kartta
Espooblues.com
HugeDomains.com

Recently Updated Websites

Healthhairquote.com (9 seconds ago.)Geosnyc.com (9 seconds ago.)Fiveofive.org (12 seconds ago.)Dimitrology.com (14 seconds ago.)Anniversary.esdlife.com (15 seconds ago.)Acmeexecutivesearch.com (15 seconds ago.)Connect.reddotpayment.com (16 seconds ago.)Geenaandfrankie.com (16 seconds ago.)Exclusive-nailart.com (17 seconds ago.)Artiss.co.uk (18 seconds ago.)Au1.qualtrics.com (19 seconds ago.)Dehack.ir (23 seconds ago.)Kotri-shop.ru (24 seconds ago.)Nopressuresores.com (24 seconds ago.)Private.invoice4u.co.il (25 seconds ago.)Physicianleadershipconference.com (27 seconds ago.)Myfreelive.xyz (29 seconds ago.)Ofcaonline.org (29 seconds ago.)Tribetalk.org (30 seconds ago.)Lexlaudeabogados.com (31 seconds ago.)Heroscreen.cc (33 seconds ago.)Aji-box.com (34 seconds ago.)Trennplex.com (36 seconds ago.)Quizier.com (41 seconds ago.)Devfactory.com (44 seconds ago.)Mediamarketingmethods.org (45 seconds ago.)Getcuttingtools.net (46 seconds ago.)Sydxb705.com (47 seconds ago.)Wpcharms.com (50 seconds ago.)Craigsy.com (52 seconds ago.)

Recently Searched Keywords

[트랜드] 간호사취업공황 (1 second ago.)mathrandomtostring36substring2 15 (1 second ago.)beep beep richie 1990 vs 2017 (1 second ago.)norvegesi (1 second ago.)「網軍上得了檯面嗎?」王世堅嗆邱昱凱:敢接悠遊卡總經理就議會見 (1 second ago.)downtown raleigh catering (2 seconds ago.)phone screen (2 seconds ago.)monsieur cuisine (2 seconds ago.)new designer dress images 2020 (2 seconds ago.)durand (3 seconds ago.)garden fence (3 seconds ago.)conrad hilton (4 seconds ago.)theroxcafe (4 seconds ago.)rope extreme (4 seconds ago.)damit umgehen synonym (4 seconds ago.)dois mil (4 seconds ago.)陶瓷电容 (5 seconds ago.)nodename (5 seconds ago.)algorand price (5 seconds ago.)should try another one. (5 seconds ago.)vi sker 2 (6 seconds ago.)return target (6 seconds ago.)babybauchshooting (6 seconds ago.)book explains basic (7 seconds ago.)legalzoom promo code (7 seconds ago.)1998 chevy malibu (8 seconds ago.)dali китай (8 seconds ago.)podlaskie biaystok (8 seconds ago.)кофейные сервизы (8 seconds ago.)e-mail un (8 seconds ago.)