Ess-chax.ch Favicon Ess-chax.ch

Ess-chax.ch Website Thumbnail
Checking...
Swiss Ski & Snowboard school of Chateau D'Oex
Low trust score
Add a review Change category Claim this site
Ski, snowboard and telemark lessons. Private and group lessons. Freeride. Ski and snowshoe hikes. Theme parties.


Domain summary

Domain label
ess-chax
Domain extension
ch
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is ess-chax.ch ranked relative to other sites:

Percentage of visits to ess-chax.ch from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ess-chax.ch registered?
A: Ess-chax.ch was registered 19 hours, 5 minutes, 28 seconds ago on Friday, October 30, 2020.
Q: When was the WHOIS for Ess-chax.ch last updated?
A: The WHOIS entry was last updated 19 hours, 5 minutes, 28 seconds ago on Friday, October 30, 2020.
Q: What are Ess-chax.ch's nameservers?
A: DNS for Ess-chax.ch is provided by the following nameservers:
  • ns9.wixdns.net
  • ns8.wixdns.net
Q: Who is the registrar for the Ess-chax.ch domain?
A: The domain has been registered at SWITCH Domain Name Registration.
Q: What is the traffic rank for Ess-chax.ch?
A: Ess-chax.ch has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ess-chax.ch each day?
A: Ess-chax.ch receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ess-chax.ch resolve to?
A: Ess-chax.ch resolves to the IPv4 address 23.236.62.147.
Q: In what country are Ess-chax.ch servers located in?
A: Ess-chax.ch has servers located in the United States.
Q: What webserver software does Ess-chax.ch use?
A: Ess-chax.ch is powered by webserver.
Q: Who hosts Ess-chax.ch?
A: Ess-chax.ch is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Ess-chax.ch worth?
A: Ess-chax.ch has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Ess-chax.ch?

Ess-chax.ch Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Ess-chax.ch

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Fri, 30 Oct 2020 08:25:32 GMT
Content-Length: 0
Connection: keep-alive
location: https://en.ess-chax.ch/
x-wix-request-id: 1604046332.278569173296435715198
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: gv/XVF9HsGpk8A2KWukUzOwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgAmI6NXu6WfqLI/M7f8tcV,2d58ifebGbosy5xc FRalnhhbvKD7qPap0VMwQu fU45bKJz3vRFgAucCPt352Nn Q/rxS2XVA24szAo/QVFpQ==,2UNV7KOq4oGjA5 PKsX47COQw3BjVFoMBu6hWXG/pBM=,m0j2EEknGIVUW/liY8BLLrirsZ1spqO hQFruvtAKWs=,8Jozq2XDr5/0Pv3E0yMnd8LT0ZKATnwJEUSsDZ7ByOhGp/J3MBzgzU8QHrQuh4zQ,znxyTGNb715cyF9N4jtLDGIYynmdRM8FGINuWDsT8eWKZihIYgrrxY2NFbZWGkDp
Cache-Control: no-cache
Expires: -1

Ess-chax.ch Domain Nameserver Information

HostIP AddressCountry
ns9.wixdns.net 216.239.34.101
ns8.wixdns.net 216.239.32.101


Need to find out who hosts Ess-chax.ch?


Domain Registration (WhoIs) information for Ess-chax.ch

 Requests of this client are not permitted. Please use https://www.nic.ch/whois/ for queries. 

Ess-chax.ch Free SEO Report

Website Inpage Analysis for Ess-chax.ch

H1 Headings

4 :
  1. Swiss Ski and Snowboard School of Château-d'Oex
  2. [email protected] 
  3. +41 26 924 68 48 

H2 Headings

0 :

H3 Headings

4 :
  1. Our school offers a wide range of courses, and snowsports activities, suitable for all levels.
  2. SCHEDULES
  3. CONTACT

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

9 :
  1. Snow garden
  2. Group lessons
  3. Private lessons
  4. Freeriding
  5. Freestyle
  6. Skitouring
  7. Snowshoe touring
  8. Coaching for competition
  9. Events

Total IFRAMEs

2 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

10:
  1. Ess-chax Swiss Ski and Snowboard School of 
    https://en.ess-chax.ch
  2. Ess-chax Accueil
    https://en.ess-chax.ch
  3. Ess-chax Services
    https://en.ess-chax.ch/services
  4. Ess-chax Team
    https://en.ess-chax.ch/team
  5. Ess-chax Contact
    https://en.ess-chax.ch
  6. https://en.ess-chax.ch?lightbox=dataItem-k41ak5321
    https://en.ess-chax.ch?lightbox=dataItem-k41ak5321
  7. https://en.ess-chax.ch?lightbox=dataItem-k4ii44u91
    https://en.ess-chax.ch?lightbox=dataItem-k4ii44u91
  8. https://en.ess-chax.ch?lightbox=dataItem-k41ak532
    https://en.ess-chax.ch?lightbox=dataItem-k41ak532
  9. https://en.ess-chax.ch/services
    https://en.ess-chax.ch/services
  10. Ess-chax Haut de page
    https://en.ess-chax.ch

Links - Internal (nofollow)

0:

Links - Outbound

4:
  1. http://www.instagra.com/esschax
    http://www.instagra.com/esschax
  2. http://www.facebook.com/esschax
    http://www.facebook.com/esschax
  3. Ess-chax Webcam
    https://chax.roundshot.com/
  4. Ess-chax Weather Forecast
    https://www.meteosuisse.admin.ch/home.html?tab=overview

Links - Outbound (nofollow)

0:

Keyword Cloud for Ess-chax.ch

calc100 980pxrange90255 1 stylekfa9pipqnavcontainerborderwidth2px borderstylesolidbordercolorrgba249positionfixed importantleftauto importantzindex50normal 18px14emtextaligncenter25 13px rgba0stylek3x61lv4horizontalsuitable for adultsselectfocusnormal normal normalborderwidth1px backgroundcolorrgba212 21218px14em chelsea marketfantasy6overflowhiddensealskin and snowshoe249 249 1backgroundcolorrgba255255 1 stylekfl7zhgznavcontainerstylek3x61lv4dropdownwrapperbackgroundcolorrgba255snowshoestrc1inlinecontentimportantzindex50borderwidth2pxbordercolorrgba204helveticaneuew1055romaborderstylesolidbordercolorrgba249 249 249stylekfa9pipqnavcontainerarrowstylekfa9pipqnavcontainerrightdirectionhelveticaneuew1055roma helvetica1borderstylesolidbordercolorrgba246stylek3x61lv4languagebuttonspacerstylekfl7zhgznavcontainerborderstylesolidbordercolorrgba249 2494treks theme partiesmetakeywordsseopagetitleseoservicessnowshoe hikesstylekfa9pipqnavcontainercolor323232backgroundcolorrgba246ifimportantleftautofreeride and freestylestylekfa9pipqnavcontainerarrowstylekfa9pipqnavcontainerleftdirectionmargin0 14px1backgroundcolorrgba255freestyle sealskintransitionopacity 05s ease249 249ultxtnewoldirrtlall levelsnsnow249 1backgroundcolorrgba255255 255 1normal 18px14em basicsansserif1borderstylesolidbordercolorrgba246 4 25svgsuitablefont normal5borderradius0kidstelemark lessons privatergba0 0 04px stylek3x61lv4languagebuttoncenterbackgroundcolorrgba212 212swiss ski1borderstylesolidbordercolorrgba246 411212 1borderstylesolidbordercolorrgba0 0stylekfa9pipqnavcontainerrightdirection1borderstylesolidbordercolorrgba0coursesopacity1opensnowboard and telemarkpartiesmetakeywordsseopagetitleseoservices swiss ski18px14emhelveticaneuew0255roma helveticaneuew1055romatheme partiesmetakeywordsseopagetitleseoservices swissralewaysansserif color39729barial243 24314px14emstylekfl7zhgznavcontainerrightdirectionfont normal normalstylek3x6awocdataresponsivetransitioncolor 04s ease255 2551 0pxsnowshoe trekscalc100 980px 05normal normal 18px14emdoexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices swisscourses suitable10fontnormal normal normalstylekfl7zhgznavcontainersvgcontainerstylek3x61lv4languagebuttonleftneuegroup lessons22px14emchelsea marketfantasyselectdatapreviewerrortelemark lessons05s ease1borderradius0borderstylesolidbordercolorrgba249lessons privatestylek3x61lv4mobilelanguageselectorstylekfl80m45link0 0 0normal normal1px 3px rgba0allstylek3x61lv4languagebuttonlabelstylek3x61lv4languagebuttonhastextleft10pxright10pxstylek41afkezautoplayfontnormalfontnormal normal0 0 11backgroundcolorrgba255 255 255freestylestylekfl85h0ylinkmargin0lineheightnormalletterspacingnormal txtnewease 0strekshelveticaneuew1055roma helvetica arialcolor323232backgroundcolorrgba246 4 25243 1borderstylesolidbordercolorrgba246 4marketfantasy color000000wordbreakbreakworddisplayinlineblocklineheight1sealskineasemargin0stylek3x61lv4languagebuttoniconstylek3x61lv4languagebuttonhasicon margin01borderwidth0pxborderradius0 0 0fill323232telemarkultxtnew olselectdataerrortruebackgroundcolor ffffffchateau doexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices swissski snow000000selectdatapreviewhoversolid rgba0adults and kidsulstylekfl81lcmtextarea0 0 06swiss1borderwidth0pxborderradius0 0displaynonestylek41afkezimageitempanel0 0614sanssansseriflevelsnsnow gardenkids all levelsnsnow05sstylekfa9pipqnavcontainersvgcontainernormal14px14em basicsansserifdoextypemetapropsnamedescriptioncontentourcolordoexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices4pxstylek41afkezbuttonsselectdatapreviewerror stylekfa9pipqnavcontainerarrowhelveticabasicsansserifselectdatapreviewfocuspositionfixed importantleftautostylekfl7zhgzrepeaterbuttonlabelsnowshoe treks themehikespositionabsolutetop0left0color373737width100height10014px 0noffers a widestylekfa9pipqnavcontainerarrowopen sanssansserifmargin0lineheightnormalletterspacingnormalall levelsnsnow gardenstylekfl7zhgznavcontainerarrowstylek3x61lv4languagebuttoncenterstylek3x61lv4languagebuttonhorizontalmarginleft14pxselectdatapreviewerror stylekfl7zhgznavcontainerarrow4 251bordersolidlessons freeridedoextypemetapropsnamedescriptioncontentour schoolschool of chateaustylekfl80m45labelschool4 25 1positionfixedtextalignleft243 243 1borderstylesolidbordercolorrgba246olimportantleftauto importantzindex50private and groupborderwidth2pxbordercolorrgba204 204 204stylek3x61lv4languagebuttonlastchildstylek3x61lv4languagebuttonarrowiconfont1borderstylesolidbordercolorrgba0 0opacity00 1snowboard0px calc0px0pxcalc100stylek41afkezbtnchelseaboxshadownonenormal normal 22px14emski snowboardsolidpath18px14em chelseabackgroundcolorrgba251backgroundcolorrgba251 243 243stylek3x61lv4languagebuttoniconkids allstylekfl80m45labelwrapperswiss ski snowlevelsnsnowpadding0chateaustylekfl7zhgznavcontainerleftdirectionmarginleft calc100 980pxbackgroundcolorrgba212 212 2122stylekfa9pipqrepeaterbuttonwrapperborderwidth1px backgroundcolorrgba251 243borderright0lb1itemscontainer04s ease 0s130sgarden privatehelvetica arial94 186stylek3x61lv4dropdownstylekfl7zhgznavcontainercenterdirectionnormal 22px14emski snowboard schoolneue helveticaneuew0155roma helveticaneuew0255romargba0backgroundcolorrgba255 255 255marginleft calc100chateau doextypemetapropsnamedescriptioncontentour schoolcolor606060stylekfl7zhgznavcontainerarrow stylekfl7zhgznavcontainersvgcontainer255 10 0themelessons freeride ski04s ease3stylek3x61lv4languagebuttonpath fill323232backgroundcolorrgba255 255freeride skifreeride3pxtxtnew ulsnow schoolgrouppositionstaticboxshadow000ffffff1borderwidth0pxborderradius0backgroundcolorrgba251 243helveticaneuew0255romacontentselectstylek3x61lv4languagebuttoniconstylek3x61lv4languagebuttonhasiconmargin0 4pxneue helveticaneuew0155romastylekfa9pipqnavcontainerarrow stylekfa9pipqnavcontainersvgcontainerborderwidth2pxbordercolorrgba204 204062134stylek3x61lv4currentlanguagergba0 011 stylekfl7zhgznavcontainercalc0px 0pxcalc0px204 204 1chelsea marketfantasy color000000wordbreakbreakworddisplayinlineblocklineheight120pxstylekfl82bakinputstrc1dataresponsivetreks themenormal 18px14em chelseastylekfa9pipqnavcontainerleftdirectionbackgroundcolorrgba246212 212 1borderstylesolidbordercolorrgba0helveticaneuew0155roma helveticaneuew0255romatheme partiesmetakeywordsseopagetitleseoservicesoffersstylek3x61lv4languagebuttonlabelstylek3x61lv4languagebuttonhastext margin0204 204txtnewborderwidth1pxchateau doextypemetapropsnamedescriptioncontentourpositionabsolutetop0right0bottom0left0borderradius0stylek3x61lv4languagebuttoncenterstylekfl85h0ylabeladultsralewaysansserif4px 0px3px rgba0 0color000000243 1borderstylesolidbordercolorrgba246color000000wordbreakbreakworddisplayinlineblocklineheight1249 1backgroundcolorrgba255 255212 212partiesmetakeywordsseopagetitleseoservices4 25 1borderwidth0pxborderradius0color323232backgroundcolorrgba246 4stylekfl85h0ylabelwrapperwidetransitionopacity 05svarstylek3ynl4x9bgtransitionopacityschool offersrange of coursessnowboard schoolright0borderleftwidth1pximportantstylekfl7zhgznavcontainerarrowstylekfl7zhgznavcontainercenterdirection04sstylek41fqmhrbg05s ease 0sborderwidth2px borderstylesolidbordercolorrgba249 2491backgroundcolorrgba255 255color39729bborderwidth1px backgroundcolorrgba251stylekfa9pipqrepeaterbuttonlabelhikes theme25 1borderwidth0pxborderradius0privateborderwidth1px backgroundcolorrgba2121 stylekfa9pipqnavcontainer204 17displaywebkitboxdisplaywebkitflexdisplayflexwebkitboxorientverticalwebkitboxdirectionnormalwebkitflexdirectioncolumnflexdirectioncolumnpositionabsolutetop0right0bottom0left005normal normal 14px14em1c95efstylekfl7zhgznavcontainerarrowstylekfl7zhgznavcontainerleftdirection15positionstaticboxshadow000 0stylekfa9pipqnavcontainerarrowstylekfa9pipqnavcontainercenterdirection8normal 14px14em157 2091borderstylesolidbordercolorrgba0 0 0selecthovernormal 14px14em basicsansserifhelveticaneuew0155romastylekfl7zhgznavcontainerarrowstylekfl7zhgznavcontainerrightdirectionski snow schoolsnowshoe hikes themesolid rgba0 025 1borderwidth0pxborderradius0 0stylek3x61lv4dropdown stylek3x61lv4dropdownwrappertransitioncolor 04s1px 3pxtransitioncolorstylekfa9pipqnavcontainercenterdirectionbackgroundcolorrgba212helveticaneuew0255roma helveticaneuew1055roma helvetica12marketfantasy18px14em basicsansseriftopautobottom01pxbackgroundcolor0px calc0px 0pxwide rangegardenstylek3x61lv4languagebuttonrightborderwidth2px0 14px980pxlevelsnsnow garden privatecolor ffffffsnowhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romadoexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices swiss skimargin0 14px 0lessonspositionstaticboxshadow000 0 0212 1borderstylesolidbordercolorrgba0group lessons freeridedoextypemetapropsnamedescriptioncontentour school offers0 1 0pxpartiesmetakeywordsseopagetitleseoservices swissskiol ulchateau doexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservicesski and snowshoestylek3x6awocinlinecontent06980px 05

Longtail Keyword Density for Ess-chax.ch

KeywordsOccurences
calc100 980px 0526
margin-left calc100 980px26
private and group24
school of chateau24
group lessons freeride24
range of courses19
offers a wide19
swiss ski snow18
adults and kids18
kids all levelsnsnow18
all levelsnsnow garden18
levelsnsnow garden private18
ski snow school18
suitable for adults18
freeride and freestyle18
sealskin and snowshoe18
snowshoe treks theme18
fontnormal normal normal15
normal normal 18px14em15
rgba0 0 013
0 0 112
normal normal normal11
font normal normal11
04s ease 0s11
normal 18px14em chelsea10
18px14em chelsea marketfantasy10
doexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices swiss ski9
chateau doextypemetapropsnamedescriptioncontentour school9
4 25 19
1background-colorrgba255 255 2559
chateau doexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices swiss9
treks theme partiesmetakeywordsseopagetitleseoservices9
theme partiesmetakeywordsseopagetitleseoservices swiss9
partiesmetakeywordsseopagetitleseoservices swiss ski9
doextypemetapropsnamedescriptioncontentour school offers9
255 255 18
249 1background-colorrgba255 2557
249 249 1background-colorrgba2557
border-stylesolidborder-colorrgba249 249 2497
05s ease 0s7
border-width2px border-stylesolidborder-colorrgba249 2497
0 0 07
snowboard and telemark6
telemark lessons private6
lessons freeride ski6
ski and snowshoe6
snowshoe hikes theme6
ski snowboard school6
1border-stylesolidborder-colorrgba0 0 06
background-colorrgba255 255 2556
1border-stylesolidborder-colorrgba246 4 255
1border-width0pxborder-radius0 0 04
255 1 style-kfl7zhgznavcontainer4
border-width2pxborder-colorrgba204 204 2044
chelsea marketfantasy color000000word-breakbreak-worddisplayinline-blockline-height14
0 0 064
positionstaticbox-shadow000 0 04
border-width1px background-colorrgba212 2124
background-colorrgba212 212 2124
212 212 1border-stylesolidborder-colorrgba04
212 1border-stylesolidborder-colorrgba0 04
background-colorrgba251 243 2434
243 243 1border-stylesolidborder-colorrgba2464
border-width1px background-colorrgba251 2434
243 1border-stylesolidborder-colorrgba246 44
255 1 style-kfa9pipqnavcontainer4
4 25 1border-width0pxborder-radius04
25 1border-width0pxborder-radius0 04
helveticaneuew10-55roma helvetica arial4
neue helveticaneuew01-55roma helveticaneuew02-55roma4
transitionopacity 05s ease4
helveticaneuew02-55roma helveticaneuew10-55roma helvetica4
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma4
positionfixed importantleftauto importantz-index503
normal normal 22px14em3
color323232background-colorrgba246 4 253
margin0 14px 03
204 204 13
transitioncolor 04s ease3
solid rgba0 03
0 1 0px3
normal 18px14em basicsans-serif3
normal 14px14em basicsans-serif3
normal normal 14px14em3
0px calc0px 0px3
1px 3px rgba03
3px rgba0 03
0 050
normal normal42
margin-left calc10026
calc100 980px26
980px 0526
lessons freeride24
group lessons24
swiss ski20
255 25520
wide range19
school offers19
levelsnsnow garden18
garden private18
ease 0s18
courses suitable18
freestyle sealskin18
snowshoe treks18
all levelsnsnow18
kids all18
treks theme18
ski snow18
4 2518
snow school18
fontnormal normal15
normal 18px14em15
rgba0 013
04s ease12
0 112
font normal11
18px14em chelsea10
chelsea marketfantasy10
204 2049
chateau doextypemetapropsnamedescriptioncontentour9
25 19
1background-colorrgba255 2559
theme partiesmetakeywordsseopagetitleseoservices9
partiesmetakeywordsseopagetitleseoservices swiss9
chateau doexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices9
doexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices swiss9
doextypemetapropsnamedescriptioncontentour school9
255 18
snowboard school8
05s ease7
249 2497
249 1background-colorrgba2557
margin0line-heightnormalletter-spacingnormal txtnew7
border-width2px border-stylesolidborder-colorrgba2497
border-stylesolidborder-colorrgba249 2497
lessons private6
freeride ski6
14px 06
ski snowboard6
212 2126
background-colorrgba255 2556
1border-stylesolidborder-colorrgba0 06
snowshoe hikes6
hikes theme6
telemark lessons6
1 style-kfa9pipqnavcontainer5
1 style-kfl7zhgznavcontainer5
0 14px5
style-k3x61lv4languagebuttonlabelstyle-k3x61lv4languagebuttonhas-text margin05
style-k3x61lv4dropdown style-k3x61lv4dropdownwrapper5
1 0px5
1border-stylesolidborder-colorrgba246 45
25 1border-width0pxborder-radius04
border-width1px background-colorrgba2514
helvetica arial4
helveticaneuew10-55roma helvetica4
helveticaneuew02-55roma helveticaneuew10-55roma4
helveticaneuew01-55roma helveticaneuew02-55roma4
neue helveticaneuew01-55roma4
border-width1px background-colorrgba2124
background-colorrgba212 2124
212 1border-stylesolidborder-colorrgba04
margin0 4px4
background-colorrgba251 2434
1border-width0pxborder-radius0 04
243 2434
243 1border-stylesolidborder-colorrgba2464
transitionopacity 05s4
positionstaticbox-shadow000 04
marketfantasy color000000word-breakbreak-worddisplayinline-blockline-height14
0 064
txtnew ul4
border-width2pxborder-colorrgba204 2044
style-kfl7zhgznavcontainerarrow style-kfl7zhgznavcontainersvgcontainer3
color ffffff3
204 13
background-color ffffff3
open sanssans-serif3
ralewaysans-serif color39729b3
normal 22px14em3
selectdata-previewerror style-kfl7zhgznavcontainerarrow3
transitioncolor 04s3
positionfixed importantleftauto3
color323232background-colorrgba246 43
157 2093
18px14em basicsans-serif3
1px 3px3
3px rgba03
normal 14px14em3
14px14em basicsans-serif3
0px calc0px3
calc0px 0px3
path fill3232323
importantleftauto importantz-index503
margin0 14px3
style-k3x61lv4languagebuttoniconstyle-k3x61lv4languagebuttonhas-icon margin03
4px style-k3x61lv4languagebuttoncenter3
4px 0px3
style-kfa9pipqnavcontainerarrow style-kfa9pipqnavcontainersvgcontainer3
94 1863
ol ul3
ultxtnew ol3
solid rgba03
selectdata-previewerror style-kfa9pipqnavcontainerarrow3
0113
normal74
school45
142
240
background-color38
color37
ski33
lessons30
0527
margin-left26
calc10026
980px26
private24
chateau24
theme24
group24
freeride24
snowshoe24
swiss20
320
snow19
all19
suitable19
courses19
range19
wide19
offers19
ease19
418
txtnew18
treks18
518
freestyle18
garden18
sealskin18
levelsnsnow18
kids18
adults18
0s18
important17
positionabsolutetop0right0bottom0left016
0px15
fontnormal15
18px14em15
614
snowboard14
style-kfa9pipqnavcontainer13
rgba013
style-kfl7zhgznavcontainer13
displaynone13
712
solid12
margin012
04s12
style-kfa9pipqnavcontainerarrow11
font11
14px11
border-width1px11
style-kfl7zhgznavcontainerarrow11
chelsea10
opacity110
marketfantasy10
ul10
partiesmetakeywordsseopagetitleseoservices9
border-radius09
4px9
1background-colorrgba2559
doextypemetapropsnamedescriptioncontentour9
doexpageuriseoserviceshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrenservices9
basicsans-serif9
88
1px8
border-width2px8
05s7
ol7
style-k3x61lv4dropdown7
margin0line-heightnormalletter-spacingnormal7
style-k3x61lv4languagebuttonarrow-icon7
style-k3x61lv4languagebutton7
var7
padding07
ralewaysans-serif7
color0000007
border-stylesolidborder-colorrgba2497
style-k3x61lv4languagebuttonlabelstyle-k3x61lv4languagebuttonhas-text6
ffffff6
style-kfl7zhgznavcontainerarrowstyle-kfl7zhgznavcontainerleft-direction6
1border-stylesolidborder-colorrgba06
background-colorrgba2556
style-k3x61lv4horizontal6
style-kfl81lcmtextarea6
telemark6
style-kfa9pipqnavcontainerarrowstyle-kfa9pipqnavcontainerleft-direction6
arial6
style-k3x61lv4dropdownwrapper6
hikes6
selecthover6
style-kfl82bakinput6
style-kfa9pipqnavcontainerarrowstyle-kfa9pipqnavcontainerright-direction6
style-kfl7zhgznavcontainerarrowstyle-kfl7zhgznavcontainercenter-direction6
style-kfl7zhgznavcontainerarrowstyle-kfl7zhgznavcontainerright-direction6
selectdata-previewerror6
selectdata-errortrue6
selectdata-previewfocus6
selectdata-previewhover6
selectfocus6
style-kfa9pipqnavcontainerarrowstyle-kfa9pipqnavcontainercenter-direction6
select5
ultxtnew5
style-k3x61lv4languagebuttonright5
positionabsolutetop0right0bottom0left0border-radius05
065
1border-stylesolidborder-colorrgba2465
style-k3x61lv4languagebuttonleft5
style-k41afkezautoplay5
svg5
if5
style-kfl80m45labelwrapper5
positionabsolutetop0left0color373737width100height1004
neue4
style-kfl80m45label4
style-k3x61lv4languagebuttoniconstyle-k3x61lv4languagebuttonhas-icon4
style-k3x61lv4languagebuttoncenter4
helveticaneuew01-55roma4
style-k41afkezimageitempanel4
helvetica4
helveticaneuew10-55roma4
94
overflowhidden4
helveticaneuew02-55roma4
n4
path4
border-width2pxborder-colorrgba2044
lb1itemscontainer4
background-colorrgba2464
style-kfl85h0ylabelwrapper4
style-kfl85h0ylink4
style-kfl85h0ylabel4
style-kfl7zhgzrepeaterbuttonlabel4
104
content4
color000000word-breakbreak-worddisplayinline-blockline-height14
1bordersolid4
right0border-left-width1px4
color6060604
background-colorrgba2124
border-right04
background-colorrgba2514
1border-width0pxborder-radius04
color39729b4
open4
0621344
transitionopacity4
1c95ef4
style-k3x61lv4languagebuttonlast-child4
0000004
positionstaticbox-shadow0004
14px14em4
114
sanssans-serif3
22px14em3
display-webkit-boxdisplay-webkit-flexdisplayflex-webkit-box-orientvertical-webkit-box-directionnormal-webkit-flex-directioncolumnflex-directioncolumn3
style-k41fqmhrbg3
left10pxright10px3
style-k3ynl4x9bg3
style-kfl7zhgznavcontainersvgcontainer3
style-kfl7zhgznavcontainercenter-direction3
topautobottom03
1border-radius03
style-kfl7zhgznavcontainerleft-direction3
importantleftauto3
positionfixed3
text-alignleft3
style-kfl7zhgznavcontainerright-direction3
importantz-index503
box-shadownone3
text-aligncenter3
style-kfl80m45link3
fill3232323
style-k3x61lv4languagebuttonicon3
style-k3x61lv4languagebuttonspacer3
style-k3x61lv4mobilelanguageselector3
calc0px3
style-k3x61lv4currentlanguage3
20px3
style-k3x61lv4languagebuttoncenterstyle-k3x61lv4languagebuttonhorizontal3
3px3
style-k41afkezbtn3
style-k41afkezbuttons3
opacity03
123
133
oldirrtl3
143
style-kfa9pipqnavcontainersvgcontainer3
style-kfa9pipqnavcontainerleft-direction3
style-kfa9pipqnavcontainerright-direction3
transitioncolor3
style-kfa9pipqnavcontainercenter-direction3
style-kfa9pipqrepeaterbuttonwrapper3
style-kfa9pipqrepeaterbuttonlabel3
color323232background-colorrgba2463
style-k3x6awocdata-responsive3
style-k3x6awocinlinecontent3
strc1data-responsive3
strc1inlinecontent3
153

Ess-chax.ch Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Ess-caraibes.org
ess-caraibes.org
Ess-chax.ch
Swiss Ski & Snowboard school of Chateau D'Oex
Ess-company.com
ess-company – ess-company
Ess-company.net
ess-company – ess-company
Ess-cup.com
Checkdomain Parking - www.ess-cup.com

Recently Updated Websites

Investor-gesucht.org 2 seconds ago.Manaratjumeira.com 2 seconds ago.Uniquelymineral.com 4 seconds ago.Unitechtv.us 4 seconds ago.Shennonggao.com 5 seconds ago.Swift-iban.pl 5 seconds ago.Cangkringan.com 5 seconds ago.Ppcomputerrepair.com 6 seconds ago.Phoenixdiadelosmuertos.com 7 seconds ago.Caaf.cz 7 seconds ago.Accidentedenver.com 7 seconds ago.Resultsimc.com 8 seconds ago.Pikadime.com 9 seconds ago.Dastakindia.org 9 seconds ago.Mappinguncertaintyinmedicine.org 9 seconds ago.Deepclubs.com 9 seconds ago.Bcrm-bg.org 9 seconds ago.Brotherskeeperintl.org 10 seconds ago.Tarellano.com 11 seconds ago.Buddywoodinsurance.com 11 seconds ago.Fungusover.com 12 seconds ago.Brijia.com 13 seconds ago.Myflowerfinder.com 13 seconds ago.Yanxianiangzao.com 14 seconds ago.Fffilm.name 14 seconds ago.Manymo.com 14 seconds ago.Caraccidentlasvegaslv.com 15 seconds ago.Metsballers.com 15 seconds ago.Thesustainabilitycouncil.org 16 seconds ago.Geld-online-blog.de 16 seconds ago.