Best Cheap Essay Writing Services for Affordable Price | Research Papers, Term Papers, Dissertation & Thesis Works


Domain summary

SafetyLow trust score
Year Founded
2010
Global Traffic Rank
110,555
Estimated Worth
$113,400
Last updated
2022-03-11
Domain label
essayservices
Domain extension
org
Domain registered:
2010-08-14
Domain updated:
2022-03-11
Statvoo Rating
F
Estimated daily income
$189
Estimated monthly income
$5,749

Frequently Asked Questions (FAQ)

Q: When was Essayservices.org registered?
A: Essayservices.org was registered 11 years, 10 months, 2 weeks, 5 days, 15 hours, 2 minutes, 8 seconds ago on Saturday, August 14, 2010.
Q: When was the WHOIS for Essayservices.org last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 1 day, 15 hours, 2 minutes, 8 seconds ago on Friday, March 11, 2022.
Q: What are Essayservices.org's nameservers?
A: DNS for Essayservices.org is provided by the following nameservers:
  • kyree.ns.cloudflare.com
  • ophelia.ns.cloudflare.com
Q: Who is the registrar for the Essayservices.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Essayservices.org?
A: Essayservices.org ranks 110,555 globally on Alexa. Essayservices.org has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Essayservices.org each day?
A: Essayservices.org receives approximately 15,124 visitors and 75,620 page impressions per day.
Q: What IP address does Essayservices.org resolve to?
A: Essayservices.org resolves to the IPv4 address 172.67.186.46.
Q: In what country are Essayservices.org servers located in?
A: Essayservices.org has servers located in the United States.
Q: What webserver software does Essayservices.org use?
A: Essayservices.org is powered by CloudFlare webserver.
Q: Who hosts Essayservices.org?
A: Essayservices.org is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Essayservices.org worth?
A: Essayservices.org has an estimated worth of $113,400. An average daily income of approximately $189, which is roughly $5,749 per month.

Essayservices.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Essayservices.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Essayservices.org

H1 Headings

1 :
  1. Expert Custom Essay Services

H2 Headings

0 :

H3 Headings

2 :
  1. Ordering with us is Easy, Safe and Secured
  2. Testing a writer before you Pay sounds good?

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

63 :

Links - Internal

47:

Links - Internal (nofollow)

0:

Links - Outbound

1:

Links - Outbound (nofollow)

0:

Keyword Cloud for Essayservices.org

want0 4pxyou shouldinformationbackbackgroundcolortakebest essay writingfiguresnbsp nbsp nbspcollege0 4px whitethroughcompleteborderradiusknowledgeour clientstheysubjectfieldwe haveworkcomeessay writing researchstudycustomer supportyourthinkbefore4px white 0valiresultorderwhite 0reasondissertation writing serviceacademicnowall overwriteget youreducationknowemailwe provide6px 4px 989898writing serviceexpository essaycustomersevidentwhy wewriting serviceshasdifferentclientschecksbutwhy you shouldwhiteagainmostpasswordbookright40pxwriterbuyresearchperfect pieceour best5pxpaddingthereweeachessay serviceouraroundsupporteverypieceonebecausemindenter valid emailpresentsuccesswriting researchprovidethesetrueperfectqualityif youintowritersvarnone6pxno2impressiveuphave0 6pxused3usatimeusheight0 0 0admissionpeopleessay writingvalid emailentergrades4px 989898themboxshadowall4dissertation writingenter valid0 0 4pxcheckedworkswe believepaperpaper writingservicesworldessayservicesorgessaysulhowworklistnbsp nbspassignmentssamesolidcertainprofessionalchoosereadergovaluebestexperiencesatisfactionthen againcourse workgreatfalsequality checksexcellenceterm paperyoucustom essayusa and ukour customdoesntwrittensomething0pxcourseessay writerswhy youtype of essaytopicifbelieveprofessionalsdraft servicegenuinecustomer0 0wellhenceessay writing servicemoremanycasestudentsregconfirmpasswordessay shouldbest essaycomes6px 4pxname4px whitethentermcheapoftencontentconfirmnot justcanplagiarismonlybeing0 6px 4pxhelpdocustom essay writingshouldsofontsizeplatformfffidwe presentcreatesignupwrapperanythingukgoodstudent10pxcountless1projectreputationtodaysurefuturedissertationcomparefunctionnbspalsothinkingboxshadow 0essay writing servicestopicscustomexpositoryfieldemptyyou canneedsbackgroundserviceprocess1pxessayemail idwritingwhichgetvaliresult 1admission essaybeentheirnotjustwhyneverreturncheap essaypointdescriptiveover0very20px4pxwhite 0 6pxcolorheshecheap essay writingvaliddraftelsemaketypeprofessional writerspapers

Longtail Keyword Density for Essayservices.org

KeywordsOccurrences
essay writing service12
cheap essay writing8
custom essay writing6
essay writing services6
best essay writing4
nbsp nbsp nbsp4
dissertation writing service4
enter valid email4
essay writing research3
0 0 4px3
6px 4px 9898983
0 6px 4px3
usa and uk3
white 0 6px3
4px white 03
0 4px white3
why you should3
type of essay3
0 0 03
essay writing30
writing service18
custom essay9
you can9
nbsp nbsp9
0 09
cheap essay8
valiresult 17
paper writing7
writing services6
best essay5
dissertation writing5
email id5
enter valid4
draft service4
get your4
essay writers4
essay service4
expository essay4
professional writers4
valid email4
we have4
admission essay4
writing research4
essay should3
perfect piece3
our clients3
all over3
we believe3
if you3
quality checks3
not just3
you should3
then again3
white 03
why you3
we provide3
why we3
0 6px3
our best3
customer support3
our custom3
course work3
term paper3
0 4px3
4px white3
box-shadow 03
4px 9898983
6px 4px3
we present3
essay99
writing59
you51
we47
our39
nbsp32
service30
your28
essays26
can24
024
not19
students19
have19
all18
essayservicesorg17
us17
var16
paper14
dissertation13
their13
quality12
so12
custom12
services12
research11
111
get10
but10
work10
writers10
should10
academic10
0px10
has10
professional9
function9
why9
there9
valiresult9
email9
enter8
good8
best8
comes8
because8
signup-wrapper8
cheap8
papers7
more7
password7
admission7
used7
else7
no7
valid6
they6
something6
type6
usa6
customer6
expository6
student6
white6
4px6
draft6
every6
one6
if6
then6
time6
26
world6
again6
well6
most5
subject5
present5
these5
just5
written5
perfect5
which5
do5
different5
now5
name5
piece5
study5
support5
uk5
id5
doesnt5
padding5
being5
term5
content5
back4
many4
satisfaction4
heshe4
fff4
reader4
book4
college4
provide4
none4
experience4
10px4
people4
box-shadow4
checks4
impressive4
order4
over4
certain4
also4
case4
customers4
professionals4
future4
needs4
return4
write4
fieldempty4
take4
want4
writer4
false4
true4
mind4
process4
great4
reputation4
today3
topics3
value3
project3
through3
topic3
same3
hence3
make3
never3
clients3
anything3
compare3
platform3
education3
descriptive3
sure3
believe3
evident3
often3
checked3
figures3
know3
point3
been3
complete3
only3
knowledge3
font-size3
field3
works3
information3
confirm3
ulhowwork-list3
20px3
solid3
1px3
background-color3
regconfirmpassword3
color3
5px3
40px3
height3
border-radius3
33
6px3
background3
43
plagiarism3
success3
help3
reason3
each3
think3
create3
grades3
very3
right3
them3
into3
countless3
around3
course3
go3
come3
thinking3
assignments3
up3
excellence3
buy3
before3
genuine3
choose3

Who hosts Essayservices.org?

Essayservices.org Hosting Provider Information

Hosted IP Address:172.67.186.46
Hosted Hostname:172.67.186.46
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6166%
GOOGLE
14.4366%
AS-26496-GO-DADDY-COM-LLC
3.5285%
NAMECHEAP-NET
3.2196%
AMAZON-AES
2.2918%
GoDaddy.com, LLC
2.0510%
UNIFIEDLAYER-AS-1
2.0307%
Fara Negar Pardaz Khuzestan
1.6758%
CONFLUENCE-NETWORK-INC
1.5015%
AMAZON-02
1.4722%
T-Mobile USA, Inc.
1.2679%

Essayservices.org Domain Nameserver Information

HostIP AddressCountry
kyree.ns.cloudflare.com 162.159.44.207
ophelia.ns.cloudflare.com 162.159.38.248

Websites with Similar Names

Essay-about-business.xyz
essay-about-business.xyz
Essay-about.com
Account has been suspended
Essay-about.net
えくてと Official Site
Essay-about.org
essay-about.org – Essay Blog
Essay-all-stars.com
Trusted Essay Writing Services Reviews
Essay-all.com
essay-all.com | 521: Web server is down
Essay-are-easy.site
essay-are-easy.site
Essay-assist.com
Essay-Assist.com: Essay Writing Assistance from Expert Writers

Recently Updated Websites

Asian-aerocad.com (5 seconds ago.)Vrsecure.net (7 seconds ago.)Cimug.ucaiug.org (9 seconds ago.)Arielnewman.com (9 seconds ago.)Andamanmassage-beauty.com (13 seconds ago.)Ef.co.nz (14 seconds ago.)Poorvikamobiles.co (14 seconds ago.)100daysofadventures.com (15 seconds ago.)Friedmancpa.net (17 seconds ago.)Dignityandrespect.org (17 seconds ago.)Hozo.biz (19 seconds ago.)Dara.link (22 seconds ago.)Windowclerk-sl.com (24 seconds ago.)Bingtech-systems.com (24 seconds ago.)Kidzmusic.com (24 seconds ago.)Doggosapien.com (27 seconds ago.)Kensington-junior.org.uk (29 seconds ago.)Withlensiwander.com (30 seconds ago.)Usretin-aonline.com (30 seconds ago.)Greaternorwichgrowth.org.uk (32 seconds ago.)Holyfamilycathedralparish.com (32 seconds ago.)Hansteam.ca (33 seconds ago.)Jackkerouac.org (34 seconds ago.)Jersey2015results.com (35 seconds ago.)Pintersociety.org (36 seconds ago.)Monicasamazingcakes.com (36 seconds ago.)Shinwa-sp.com (36 seconds ago.)Milnrowparishce.rochdale.sch.uk (37 seconds ago.)Streamlinelogic.ca (37 seconds ago.)Taivua.net (38 seconds ago.)

Recently Searched Keywords

温度计 (1 second ago.)92 alternative (2 seconds ago.)kurdî  (3 seconds ago.)2007 2007 (4 seconds ago.)use this search (4 seconds ago.)care medical (4 seconds ago.)strack meaning (5 seconds ago.)tdi83 tdmodulewrap padding-left (6 seconds ago.)virgin tv go on firestick 2020 (6 seconds ago.)ceme is also (6 seconds ago.)undefined ajaxlogin (7 seconds ago.)solid dfdfe1 padding (7 seconds ago.)acces point-uri (8 seconds ago.)energy efficient (8 seconds ago.)plungers (8 seconds ago.)bernstein (8 seconds ago.)2022 reviews (9 seconds ago.)sortdir (9 seconds ago.)examples of similes and metaphors in the most dangerous game (9 seconds ago.)wp1s-pager-type-3 (9 seconds ago.)founder (10 seconds ago.)cart 0 product products (empty) (14 seconds ago.)post-categories ahover blog-posts-hnkbxf8szc (14 seconds ago.)devel htb (15 seconds ago.)faciles agrave (15 seconds ago.)saylan (15 seconds ago.)teenuse toetus (16 seconds ago.)photography phoenixtypemetapropsnamedescriptioncontentreal estate (16 seconds ago.)kendinden (16 seconds ago.)onbspprocesie wsppracy (17 seconds ago.)