Estateagenttoday.co.uk Website Information

Website Ranks & Scores for Estateagenttoday.co.uk

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:206,358
Majestic Rank Majestic Rank:248,306
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Estateagenttoday.co.uk

Domain Registrar: Nominet UK
Registration Date:2008-05-01  1 decade 9 months 2 weeks ago
Last Modified:2017-03-12  1 year 11 months 4 days ago

Whois information for estateagenttoday.co.uk

Full Whois Lookup for Estateagenttoday.co.uk Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Estateagenttoday.co.uk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name:
estateagenttoday.co.uk

Registrant:
Estate Angels Limited

Registrant type:
UK Limited Company, (Company number: 4260486)

Registrant's address:
Angels House
5 Albemarle Road
Beckenham
Kent
BR3 5HZ
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk

Relevant dates:
Registered on: 01-May-2008
Expiry date: 01-May-2018
Last updated: 12-Mar-2017

Registration status:
Registered until expiry date.

Name servers:
anna.ns.cloudflare.com
ben.ns.cloudflare.com

WHOIS lookup made at 16:15:04 15-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Estateagenttoday.co.uk?

Estateagenttoday.co.uk is hosted by SKKNET.NET Ltd in United Kingdom.
Estateagenttoday.co.uk has an IP Address of 91.134.177.193 and a hostname of fr-web-03.angelsgroup.org.uk and runs nginx web server.



Estateagenttoday.co.uk Web Server Information

Hosted IP Address:91.134.177.193
Hosted Hostname:fr-web-03.angelsgroup.org.uk
Service Provider:SKKNET.NET Ltd
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:nginx
Google Map of 50,12

HTTP Header Analysis for Estateagenttoday.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Content-Type: text/html; charset=UTF-8
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 22411
Accept-Ranges: bytes
Date: Mon, 25 May 2015 06:08:02 GMT
X-Varnish: 665125369
Age: 0
Via: 1.1 varnish
Connection: keep-alive


Need to find out who hosts Estateagenttoday.co.uk?

Estateagenttoday.co.uk Free SEO Report

Website Inpage Analysis for Estateagenttoday.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Estateagenttoday.co.uk

online optionshorttermevaluationreads nbspnbspnbspnbsp 1businessinvestorsagency sorryturnover triplesreadlandlordsales aftersaysmarketshortterm rentalsmortgage marketfiretradeestate agencybeforefree2conveypeoplebeenstockday5varagentagent todayviews nbspnbspnbspnbsp 0sensesectorfees0 commentsqcompanynew bloodpassportfees chargedbefore annualgo beforeletting15 augustpart of propertyteamlastweekcontenttwocould extendchaosyourmomenteditorprivateproperty franchisesponsored contentinstructionsrevenuego before annualeatdesignagentssales doctorfranchise group newreads nbspnbspnbspnbsp 2humbertshumberts couldfeaturesbanwinning moreproperty franchise groupwinningbusiness cardanotherlatestweitrsquosenglandmarc da silvasincevideogoogletagcmdpushfunctionprimeunderdid15 august 2017tipsreadscangraham norwoodbiggestwersquorenorwoodviews nbspnbspnbspnbsppartchargedmutualgomarcsorry after emailcommentsthingsagentsrsquo mutualonlineonlybreakingourhas beenallsaytriples as focusfeedbackeditor graham norwoodlat since readproperstarlandlordsnews features tradearticlebutewemove bossafterthroughyearsmplafter evaluationnbspnbspnbspnbsp 2directory archivewinning more instructionspropertyinteriorssilvafoundernbspnbspnbspnbsp 2 commentsmuchonthemarket240theybignbspmorerentalstherersquosnbspnbspnbspnbsp 1 commentstrade directory archivestartsorry afterannual estatebreaking newsmore instructionsagencynot oneyour business cardproperty auctionslotviewlook likeweeksmortgagecapitalnamedleadsshiftsmanywhichsaleseat and latgroup newuptwo weeksnortherntenantsewemovenbspnbspnbspnbsp 0 commentsafter emailrounduphereguyfocus shiftslat sincemysellsponsoredfeatures trade directoryestatenbspnbspnbspnbsp 1werereads nbspnbspnbspnbspbossrunindustrybuyingseconddoctorauctionauctions marketyour businessonloadonlineukhomesofficeproposedewemove boss namedcompliancesimonmarc dadolikesince readgrowinghaveproperty natterfuturefeatures tradepromiseonegrahamusgraham norwood editorturnoverhousingoptionsince read morenowaugust 2017groupndashweeks to godalargesttold youfranchise group60 seconddoes it say2 commentsauctions market roundupneedseemsprofilesannualspeechsorryiffirstmarket roundupwhybuying agency turnoverhumberts could extendtoldagency sorry aftersimon shinerockemailmpl interiorsarchiveextend online optionnotviewsdirectoryeasttodayovercardnews featuresletting agentnamed as partnatter3tenhasvu overyou2017 nbspnbspnbspnbspbloodeditor of eatbuying agencyagentsrsquosay on yourshifts to owneroccupiersoncenbspnbspnbspnbspannual estate agencygroup new bloodthosetrade directoryampowneroccupiersknowdatareads nbspnbspnbspnbsp 0londoncould extend onlineestate agents1 commentsaugust 2017 nbspnbspnbspnbspnorwood editorproperty auctions marketvucouncilgovernmentrsquosfocuscouldread morelandagency turnover triplesworkinginterviewextendeditor grahamdoesagency turnovernewsemail about homeauctionslookdirectoryetsales after evaluation6callmanaging directoroption to salestoday newslatestate agentbefore annual estatenewextend onlineda silvawouldfranchisetogetherinvestortriplesaugustrecentagents mutualnbspnbspnbspnbsp 01homeboss namedphotographytimesignofferingmanagingshinerock

Longtail Keyword Density for Estateagenttoday.co.uk

KeywordsOccurences
nbspnbspnbspnbsp 0 comments37
reads nbspnbspnbspnbsp 032
marc da silva16
reads nbspnbspnbspnbsp 19
nbspnbspnbspnbsp 1 comments9
views nbspnbspnbspnbsp 05
august 2017 nbspnbspnbspnbsp5
editor graham norwood5
eat and lat5
since read more5
15 august 20175
editor of eat5
graham norwood editor5
lat since read5
sorry after email5
agency sorry after5
ewemove boss named5
named as part5
email about home5
trade directory archive4
does it say4
part of property4
humberts could extend4
say on your4
extend online option4
could extend online4
your business card4
features trade directory3
reads nbspnbspnbspnbsp 23
winning more instructions3
annual estate agency3
auctions market round-up3
property auctions market3
nbspnbspnbspnbsp 2 comments3
shifts to owner-occupiers3
option to sales3
sales after evaluation3
news features trade3
property franchise group3
franchise group new3
buying agency turnover3
agency turnover triples3
go before annual3
weeks to go3
group new blood3
triples as focus3
before annual estate3
reads nbspnbspnbspnbsp48
nbspnbspnbspnbsp 037
0 comments37
da silva16
marc da16
estate agents13
nbspnbspnbspnbsp 19
graham norwood9
1 comments9
has been8
estate agency6
editor graham5
august 20175
2017 nbspnbspnbspnbsp5
views nbspnbspnbspnbsp5
read more5
estate agent5
15 august5
since read5
lat since5
norwood editor5
managing director5
sorry after5
agency sorry5
ewemove boss5
trade directory5
after email5
boss named5
your business5
mpl interiors4
directory archive4
agent today4
agentsrsquo mutual4
vu over4
business card4
property auctions4
short-term rentals4
today news4
online option4
could extend4
humberts could4
extend online4
fees charged3
told you3
sponsored content3
60 second3
not one3
2 comments3
more instructions3
sales doctor3
nbspnbspnbspnbsp 23
auctions market3
simon shinerock3
market round-up3
winning more3
after evaluation3
franchise group3
group new3
new blood3
look like3
property franchise3
breaking news3
news features3
features trade3
letting agent3
sales after3
buying agency3
before annual3
annual estate3
agents mutual3
mortgage market3
go before3
two weeks3
agency turnover3
turnover triples3
focus shifts3
property natter3
nbspnbspnbspnbsp58
comments53
reads48
property41
037
estate28
agents28
more22
has21
you20
agency16
da16
marc16
silva16
market14
business14
have14
after13
googletagcmdpushfunction13
been12
one12
new12
110
210
agent10
part10
editor10
your10
director10
graham9
norwood9
today9
sales9
news9
my8
letting8
over8
archive8
two7
say7
named7
ewemove7
group7
our7
industry7
home7
up7
mutual7
read6
all6
auctions6
not6
why6
which6
does6
since6
36
but6
views6
lat6
email6
option6
trade6
august6
eat6
private5
auction5
features5
proposed5
sign5
sorry5
mortgage5
onthemarket5
could5
humberts5
together5
us5
do5
boss5
now5
years5
can5
directory5
landlords5
investors5
recent5
company5
run5
capital5
if5
housing5
did5
online5
45
go5
managing5
would5
founder5
card4
view4
mpl4
fees4
london4
54
need4
second4
stock4
interiors4
landlord4
council4
instructions4
doctor4
ban4
we4
focus4
many4
turnover4
buying4
homes4
lot4
nbsp4
passport4
vu4
therersquos4
time4
agentsrsquo4
sense4
extend4
short-term4
rentals4
week4
sector4
article4
biggest3
q3
video3
profiles3
free2convey3
shinerock3
winning3
compliance3
here3
feedback3
onload3
var3
team3
first3
largest3
england3
offering3
data3
revenue3
tips3
round-up3
northern3
land3
sell3
prime3
uk3
east3
interview3
ten3
growing3
properstar3
through3
amp3
people3
simon3
investor3
call3
latest3
much3
day3
franchise3
seems3
once3
another3
natter3
yet3
last3
were3
blood3
chaos3
evaluation3
online-only3
promise3
like3
look3
says3
triples3
before3
annual3
weeks3
owner-occupiers3
shifts3
future3
guy3
ndash3
governmentrsquos3
know3
moment3
big3
tenants3
itrsquos3
working3
wersquore3
those3
under3
they3
leads3
fire3
charged3
office3
content3
sponsored3
told3
design3
63
start3
photography3
things3
breaking3
speech3

What are the nameservers for estateagenttoday.co.uk?

Estateagenttoday.co.uk Domain Nameserver Information

HostIP AddressCountry
anna.ns.cloudflare.com 173.245.58.102United States United States
ben.ns.cloudflare.com 173.245.59.103United States United States

Estateagenttoday.co.uk DNS Record Analysis DNS Lookup

HostTypeTTLExtra
estateagenttoday.co.ukA21576IP: 85.13.197.74
estateagenttoday.co.ukNS21600Target: ns.angelsgroup.org.uk
estateagenttoday.co.ukSOA21600MNAME: estateagenttoday.co.uk
RNAME: root.estateagenttoday.co.uk
Serial: 129
Refresh: 3600
Retry: 60
Expire: 604800
estateagenttoday.co.ukMX21600Priority: 20
Target: cluster3a.eu.messagelabs.com
estateagenttoday.co.ukMX21600Priority: 10
Target: cluster3.eu.messagelabs.com
estateagenttoday.co.ukTXT21600TXT: v=spf1 redirect=_spf.angelsgroup.org.uk

Alexa Traffic Rank for Estateagenttoday.co.uk


Alexa Search Engine Traffic for Estateagenttoday.co.uk