New Jobs in Ethiopia 2021, Vacancies in ethiopia | Ethiojobs

Safety: Low trust score
Year Founded: 2002
Global Traffic Rank: 24,051
Estimated Worth: $633,600
Category: News and Media

Find latest Jobs in Ethiopia, vacancies in Ethiopia on Ethiojobs. Apply now for Ethiopian NGO jobs, accounting and finance jobs and IT jobs. Recruitment in Ethiopia. jobs from Employment agencies.



Domain summary

Last updated
2021-04-05
Domain label
ethiojobs
Domain extension
net
Domain registered:
2002-09-24
Domain updated:
2021-02-08
Global Traffic Rank
24,051
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$633,600
Estimated daily income
$880
Estimated monthly income
$26,767

Rank summary

How is ethiojobs.net ranked relative to other sites:

Percentage of visits to ethiojobs.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ethiojobs.net registered?
A: Ethiojobs.net was registered 18 years, 6 months, 2 weeks, 6 days, 14 hours, 58 minutes, 40 seconds ago on Tuesday, September 24, 2002.
Q: When was the WHOIS for Ethiojobs.net last updated?
A: The WHOIS entry was last updated 2 months, 6 days, 14 hours, 58 minutes, 40 seconds ago on Monday, February 8, 2021.
Q: What are Ethiojobs.net's nameservers?
A: DNS for Ethiojobs.net is provided by the following nameservers:
  • ns35.domaincontrol.com
  • ns36.domaincontrol.com
Q: Who is the registrar for the Ethiojobs.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Ethiojobs.net?
A: Ethiojobs.net ranks 24,051 globally on Alexa. Ethiojobs.net has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Ethiojobs.net each day?
A: Ethiojobs.net receives approximately 73,321 visitors and 439,926 page impressions per day.
Q: What IP address does Ethiojobs.net resolve to?
A: Ethiojobs.net resolves to the IPv4 address 96.30.55.153.
Q: In what country are Ethiojobs.net servers located in?
A: Ethiojobs.net has servers located in the United States.
Q: What webserver software does Ethiojobs.net use?
A: Ethiojobs.net is powered by LiteSpeed webserver.
Q: Who hosts Ethiojobs.net?
A: Ethiojobs.net is hosted by Cogswell Enterprises Inc. in Michigan, Lansing, United States, 48917.
Q: How much is Ethiojobs.net worth?
A: Ethiojobs.net has an estimated worth of $633,600. An average daily income of approximately $880, which is roughly $26,767 per month.

Ethiojobs.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ethiojobs.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Ethiojobs.net

H1 Headings

1 :
  1. Search and Find Jobs in Ethiopia

H2 Headings

8 :
  1. Better Job. Better Talent
  2. view all Government Jobs in Ethiopia
  3. view all Jobs in Ethiopia
  4. Be Discovered in 3 Simple Steps
  5. Job Search Tips
  6. Job Interview Tips
  7. CV Tips
  8. Career Advice

H3 Headings

5 :
  1. Daily Job Updates
  2. Latest Events & Related Topics
  3. Career Advices
  4. Career Advice & News
  5. Make the most out of your job search and cut your time as job seeker short.

H4 Headings

62 :
  1. Accounting and Finance Jobs
  2. Admin, Secretarial and Cl... Jobs
  3. Agriculture Jobs
  4. Architecture and Construc... Jobs
  5. Automotive Jobs
  6. Banking and Insurance Jobs
  7. Business Development Jobs
  8. Business and Administration Jobs
  9. Communications, PR and Jo... Jobs
  10. Community Service Jobs
  11. Consultancy and Training Jobs
  12. Creative Arts Jobs
  13. Customer Service Jobs
  14. Development and Project M... Jobs
  15. Economics Jobs
  16. Education Jobs
  17. Energy Jobs
  18. Engineering Jobs
  19. Environment and Natural R... Jobs
  20. Health Care Jobs
  21. Hotel and Hospitality Jobs
  22. Human Resource and Recrui... Jobs
  23. Information Technology Jobs
  24. Languages Jobs
  25. Legal Jobs
  26. Logistics, Transport and ... Jobs
  27. Maintenance Jobs
  28. Management Jobs
  29. Manufacturing Jobs
  30. Media and Journalism Jobs
  31. Natural Sciences Jobs
  32. Pharmaceutical Jobs
  33. Purchasing and Procurement Jobs
  34. Quality Assurance Jobs
  35. Research and Development Jobs
  36. Retail, Wholesale and Dis... Jobs
  37. Sales and Marketing Jobs
  38. Science and Technology Jobs
  39. Security Jobs
  40. Social Sciences and Commu... Jobs
  41. Strategic Planning Jobs
  42. Telecommunications Jobs
  43. Jobs in Addis Ababa
  44. Jobs in Afar
  45. Jobs in Amhara
  46. Jobs in Benishangul Gumuz
  47. Jobs in Dire Dawa
  48. Jobs in Gambela
  49. Jobs in Harari
  50. Jobs in Oromia
  51. Jobs in Sidama
  52. Jobs in Somali
  53. Jobs in SNNPR
  54. Jobs in Tigray
  55. EMPLOYERS
  56. Register with us
  57. Add your CV
  58. Create Email Alert
  59. About Us
  60. Job -Seekers
  61. Employers
  62. Contact us

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

43 :

Google Adsense

:
pub-5286705355476963

Google Analytics

:
UA-36858557-1

Links - Internal

176:

Links - Internal (nofollow)

0:

Links - Outbound

8:

Links - Outbound (nofollow)

0:

Keyword Cloud for Ethiojobs.net

collecthotel apartmentchildcarry outidentifyemploymenttype array hiringorganizationalso expectedname royal hotelmonitoring evaluationbornpreventive health careaccountingreportsmobileregistrationpracticing licenselinkages and coordinationconsortium membersjuniorimplementaccording20210405talenttigray responseofficertechnical supporttwo yearsyearsaccuracybachelors degreegabriel generalhotelproject teamdrug supplycareapprovaldevelopersupport communitybased volunteerimporthishealth bureaus nbspnbspnbspnbspnbspnbspnbspnbspimc valueresearchcorps imccreationzone 1coordination mechanismsissuesroyalbritainwellmainlybuttechnical qualitymechanicstransporterplc joblocation typehealth responseunileverwrittenholderaddress486 dateposted 20210405program qualitychildrensolutionbachelorscommunitybasedplanningarray hiringorganization typeplanning and promotionpssaddresslocality eth regionfswstalent firmemploymenttypeabovereviewsolution plcago ethiopian intellectualtechnical quality implementationachieve1 jobsamp nutritionetcimc contextassistance and capacitymassida solution plchiringorganizationnbspnbspnbspnbspnbspnbspnbspnbsp workmaintainiftargetsababa addresscountryeducational requirements qualificationsarray hiringorganizationagriculturetime hiringorganization typepackagenbspnbspnbspnbspnbspnbspnbspnbsp conductoxfam programitsupdateaccountabilityprevention and responsefield teamvalueorganization name riesmid level 2workers in healthreportnbspnbspnbspnbspnbspnbspnbspnbsp at least7health carepreventive healthclientagcocommunication skillsawareness creationjobs 10share company contextpreventativeresponsibilities nbspnbspnbspnbspnbspnbspnbspnbspnutrition modalitynbspnbspnbspnbspnbspnbspnbspto manage10carries outmassidaguidelinesbestsupervisionimplementing partners mealtruestnbsp ensuresviewfield nbspnbspnbspnbspnbspnbspnbspnbspplace addresscompany joblocationnutritionalmainregistrationpracticingweeklymdecins du mondevalidawareness000000ezezuevaluationmonthly reportsengagegreat britainrequired experience seniorloginsocial sciencesshould3 daysoxfam great britaintheywork closelysupervisesuchstandard supportinggeneralbudgetservices nbspnbspnbspnbspnbspnbspnbspnbspprogrammesvulnerablefindother relatedpostaladdress addresslocality ethcomponenttype jobpostingrequirements nbspnbspnbspnbspnbspnbspnbspnbspfacilitatesimilarnecessaryaccount loginaddresscountryunderwritingpracticesstandard supporting healthnongovernmentaltechnical assistanceimpactjobposting titlemain dutiesdiplomadegreemanagement heeducational requirements nbspnbspnbspnbspnbspnbspnbspnbspfullethworedadecisionsotp and sceducational requirements educationreceptionistabilityexperience identifiertoday riesprocessclosesystemsbureaus nbspnbspnbspnbspnbspnbspnbspnbsptraining schedulefocusedstrengtheningstrengthening of linkagescashapartmentensureseventsnetworklatestlocal implementing partnersnbspnbspnbspnbspnbspnbspnbspnbsp improvingqualityhalltodaysupply management hedepartmentrequirements nbspnbspnbspnbspnbspnbspnbspnbsp collegetimesholder is alsolevel 5 yearscommunityintellectual property officepreparingmonde francedatepostedverify5xproperlyfeedbacktime hiringorganizationsoftwareprogrammedegreename internationalskillsagriculturalmechanizationreports and sharecontext httpschemaorg typeteamsuwfinancialfull timemeetalready havemanageresponse coordinatorjobs 4datanbsp responsibleworeda health bureausyear ngo experienceservicesvalue 486joblocationimplementation of mobilesubmitsupervisor nbsp2possibleassessmentsvarcompany value2 yearsaddresslocality ethcorps imc valueleaderssince20210414corporateregion addressregion addis20210415 235959associationactionyouremphasis healthevaluationsneedscategorynot limitednbspnbspnbspnbspnbspnbspnbspnbsp collegedevelopensuretitlenotplan and implementdirectlyoperationssuppliersprovide supervision technicalconsortiumhealth amp nutritionunilever futurefswincluding the onemondecomplaintstrainaction tamhnt nursepreventionpeerhealth offices specificjobseducational requirementsimplementing partners8quarterlyrequired experience midaddress typeprogramhealthcarevalidthrough 20210412outreach workersaddis ababa addresscountrynbspnbspnbspnbspnbspnbspnbsptonbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp strengtheningconsistentcommunitybased volunteerposthotel apartment plcdiplomaprofessionalcleanamp learningjobs 7expected to providemeal frameworktype organization namedays agonbspnbspnbspnbspnbspnbspnbspnbsp improving basicababa nbsp20210414 000000 employmenttypemechanisms betweenduties and responsibilitiesorderethiopia jobspositioncoordination mechanisms betweencontact130years of experiencethroughresponsibilities nbspnbspnbspnbspnbspnbspnbspnbsp improvingway000000 employmenttype arrayadditioneachemployersmdecinsprogramsvalid registrationpracticing licensestudiesdeliverdifferentresponsible for daymedical corpsst gabrielbasicaccordingly and compile5 yearsrelatedhealth amp486 datepostedtechnicalcomputerhospital hasmodalityagoclientsworkerprotocoltoday ries engineeringsalesmissiontruckexperience midoperationprogram areashealth response coordinatorrelevantdispensaryhewsdays ago alertdegree in accountingrequirements qualificationscopyvalue 370443 datepostedaddis ababa nbspwidthlevelinsuranceaddition the positionnewposition absolutehetoday international medicaladdressregion addis ababamanagercurrentlymedical corps joblocationsexenvironmenttraining requirementsjobs 9descriptionmidhelp5moreleft000000 employmenttypegbv response235959 employmenttypeaddressregion addiscandetailbackgroundplc contextvalidthrough 20210415 235959field outinstructionsmechanization or relateddocumentationexperiencekeyconsultationjunior level 1twoyouth empowermentone year ngotransporterspropercomplianceoxfam consortium members370443 datepostedtaskshuman resourcevalidthroughsupport oxfameffectiveprogram manageracrossmobile healthtype jobposting titleworkersdaily dispensarycontext httpschemaorgjobdaysunderstandgovernment jobs3supervision technicalbanksexperience seniorup to datecorpsimplementingintegrated mobilebusinessemailimplementing partners nbspnbspnbspnbspnbspnbspnbspnbspamhara and afarbscstandardsplacepovertybetween communityexcellent communicationstrengthensessionsvalidthrough 20210414years and aboveexperiencedamharachild healthgoodroyal hotel3 jobscoordinateincluding235959 employmenttype arrayall timesroyal hotel apartmentdailytravelmentordutiescommunity educational requirementsregion addressregion tigrayprojectperformguidelines nbspnbspnbspnbspnbspnbspnbspnbspinternalupdated2 jobsheadmechanics agriculturalresource4tigray todaymeal teamagrocapacity buildingyou will havefacilities assignedmarketing and salesnutrition services packageperform othergreatofficesabove work experiencename unilevertype propertyvalueimc context httpschemaorgrelationslinkagessecurityteamlogin registeraddresscountry ethpreventative health careplc context httpschemaorgbetweenpropertyvalue name internationalfollowhightechnologylogisticslevel 1 2climate changeintonbsp preparingunderinternationaljobs 1addishealth care issuespropertyonlineyear ngorelated fieldsloanscollege diplomadegreeweekly and monthlypackage as perfollowupserviceanalysisloan applicationsequipmentlocal implementingvouchersdutyago ethiopianhealth extensionplusassigned woredaprocedureshospitalworeda healthrequirements educationmsaddressregion tigray addresscountryrequiredoutreach workerababa addresscountry ethmajorsupport oxfam consortiumcontractmodel2 5 yearshealth povertyadministrativenbsp nbspapplicationsengineering share companytypeworkshopscarriesdistributionneededoffice healthwarehouseresponsiblevolunteer health workersaddis ababaqualificationsexpecteddu mondelevel 2 5essentialapprovedago alert hospitalhealth bureausrelated fieldresponse project officerpostaladdresscompaniesresponsibilitybureausskills required experienceveryintegratedalsomembersconductgbv officersafetyoffices specific dutiestrain and supportbole20210412 235959 employmenttypemonitoring and evaluationvalidthrough 20210412 235959one yearproductsrecordcompany value 370443stayeconomicsmillenniumunderstanding20210415arrivaloxfam greatgetapartment plcngo experiencevalidthrough 20210414 000000peer educationinformationtimecloselynationalpaymentsabove workpromotionsupportfilesgbvintellectual propertysupervision technical assistancenbsp processtermsmillennium hallextension workerstravelerfuturepracticalwarrantynursingdays ago ethiopianknowledgesearchtoday internationalmore thanethiopian intellectualearly referrals mechanismplcloan associateorganizationdocumentsclimatescreenedscheduleservices accordinglyroomsassistancesupplyalert hospitalnbspnbspnbspnbspnbspnbspnbspnbsp providelevel 13 days agooutgabriel general hospitalsurvivorsimproving basicngohealth extension workerscommunitybased volunteer healthdirectornbsp 0326202108offices specificukcorps joblocationpartners mealsocialposition holder shallconditionsdevelopmentstrengthening of earlyguidelinedbsyouthlevel 5supply managementhealth servicestrainingcompanysarrayhttpschemaorg type jobpostingfieldlocalweactivitiesreflectiondonorhealth officesvalue 486 datepostedbanktype propertyvalue namelocationsafeagricultural mechanizationhealth poverty actionimcnbspnbspnbspnbspnbspnbspnbspnbsp ensurenutrition serviceslevel 2annualagco productsprinciplesemploymenttype full timeamphealth workerssurveysworkadminchargeadvicetype organizationproject officerprovidedoriginalpublic healthhis supervisorcollectingagainstnowensuringmassida solutionnikathumanvolunteerdeliveryyears experiencebank statementsmachineappropriatehiringorganization typedaily implementationst gabriel generalsupport communitybasedevaluatesectorexcellentintellectual1 2 yearsrovingtimelyareajobs in ethiopiaemploymentprotection11productearlynbspnbspnbspnbspnbspnbspnbspnbsp trainyears experience identifierzonepreferredcompany contextmid levelconduct planning20210414 000000hivaidshashealth limiteddrivefieldsgabrielmhnt medicalcollectionimc value 486ries engineeringassigned as integratedshare with fieldholder shallassigneddoneday implementationbasic preventivecarryproject nbspnbspnbspnbspnbspnbspnbspnbspoffice health responsehealthmodality and dailywebsiteemployerplc addis ababadisassembledmealjunior levelpoverty action tasimpler technologymdecins dutheircompany joblocation typehttpschemaorg typeshare companydata collectioncorps imc contextuscompany context httpschemaorgtype postaladdress addresslocalityaccountantstrongdesigncustomerinternational medical corpsseniorgbv response projectreferrals mechanismtrackermarketingexperience mid levelname international medicalbalanceobjectiveslicenselikeout of whichfinance and administrative235959 employmenttype fullshare company joblocationcollegereferralnamecreatecompanyezezu plcprovideresponsibilitiespropertyvalue name riesnbsplegalegbusiness developercurrentmeal officersperpreventivemanagersimproving basic preventivechecktigrayplanstandardfacilitieslogistics sectortoolsidentifier typeethiopianplc valuedispensary and drughiringorganization type organizationaddressregionempowerment20210412 235959learningpartners nbspnbspnbspnbspnbspnbspnbspnbspfinancenonehealth facilities sheheoutreachhave an accountjoblocation typetigray addresscountry ethsenior level 5which onehead nursecompilesimpler technology plcwhichtechnology plcmanagementexperience senior levelstatementsmainly be responsibleemploymenttype fullfacilities shehecareercommunicationaddresslocalitybasic preventive healthwork experienceoxfam consortiumnew bornensure allsupportinghealth and nutritionengineeringbetterpropertyvalue name1412type postaladdressbuildingstaffnurseestablishsystemquality ampprovided servicesvolunteer healthglobalagro mechanics agriculturallinerequired experience juniormeal officerresponse projectethiopian intellectual propertyevaluation officerroleproject coordinatoryouababaregion addressregionexperience identifier typeestablishedbasednutrition and preventativeavailableregistrationpracticing license nbspnbspnbspnbspnbspnbspnbspnbspinternational medicalmonthly6ababa nbsp 03262021implementation and deliverypromotion of awarenessethiomap mapcharge of technicaltype place addresscreation on nutritionworeda health officesaccounttype placefinance unileversiteaddis ababa todaygenderintegrated mobile healthweekmechanismsmdmspecificanppcannbspnbspnbspnbspnbspnbspnbspnbspfull time hiringorganizationcare at communityplc addismhntfollow upthemamp nutrition modalityaccordinglyinvoiceday to dayhavedu monde francenutritionhealth educationframeworkpaymentskilloromiaspecific dutiesheremapscreeningdateposted 20210405governmentcompile weeklydayofficeclerkmechanics agricultural mechanizationdrugsupporting health facilitiesmaterialshe will alsobothleadyearmannerskills requiredfreeimplementedtaalertcommunity educationalmaternal and childview allcommunity componentadvancedprojects370443 dateposted 20210405performance3 yearsname the talentservices packageitemsdrug supply managementmedical corps imcnbspnbspnbspnbspnbspnbspnbspnbsp conduct planningfunctioncapacity2 5name rieshumanitariancoordinatorsimilar rolemeal teamshealth facilities assignedemploymenttype arraydocumenttipsmonitorpartners meal teamspadding 0px20210415 235959 employmenttypeethiomapassureper the standardimprovingfirmproperty officeguidingreferralscontextenquiresalso be responsiblealreadynbspnbspnbspnbspnbspnbspnbspnbsp work closelyriesoneoncetopactivityguidancepdianyroving mealpartnerspreventative healthassistantapprenticeshipnextmobile health ampsupporting healthpropertyvaluecandidatesadministrationrequired experiencehttpschemaorgsenior levelsearchpanelleastimplementationareasworkshopall providedfamilybeforeplace address typepeopleplatformssharemonitoringcommunity levelcorps joblocation type0pxplc joblocationgbv survivorsjobpostinglimitedusingcoordinator and woredapublicname ries engineeringimmediatelyupfourbuilding to healthidentifier type propertyvalueenglishwithinrequirementsgeneral hospitalposition holdermothersmarketrightsadhere1 2joblocation type placeduprovide supervisionfield office healthnbspnbspnbspnbspnbspnbspnbspnbsp support oxfamregisterothercare issuesmechanisms between communitytigray addresscountrysimplerresponseoverassociateinitiativesheheworkingname royalprovisionaddress type postaladdressallour clientwhich one year5 years experiencebsc degreeeth region addressregioneducationalemphasissupplieddrugssuccessfulvalue 370443taxhandlingfield officeoxfamlicense nbspnbspnbspnbspnbspnbspnbspnbspmedicalmaternalfrontworkers and healthprovided services accordinglyaccuratecoordination903262021experience juniorpaddingourpartsmechanism1finance unilever futureagro mechanicsotpcvregionvalid registrationpracticinginvoicessupervisorextensionearly referralsababa todayvalidthrough 20210415quality implementationafarminimumprepareabsolutenbspnbspnbspnbspnbspnbspnbspnbsp experiencedaddressregion tigrayethiopiacaseexperience junior levelsciencesmemochangeguestslatest jobsloanechofirstadministrative assistantnbspnbspnbspnbspnbspnbspnbspnbsp supportdatescthanshare company valueidentifierrecruitersidebarcssrightshall2 years experienceengineering sharefunctionalpoverty actionofficersday documentationmembers and localincludeall provided serviceshealth facilitiesassistries engineering shareeducationcustomerspostaladdress addresslocality15eth regionnbspnbspnbspnbspnbspnbspnbspnbsp college diplomadegreefranceorganization nameelsecreditaccessnumberprocessesteam nbspnbspnbspnbspnbspnbspnbspnbsporganization name internationalago alertreporting20210412heartafar region

Longtail Keyword Density for Ethiojobs.net

KeywordsOccurences
address type postaladdress20
type jobposting title20
hiringorganization type organization20
type organization name20
joblocation type place20
type propertyvalue name20
identifier type propertyvalue20
type place address20
place address type20
type postaladdress addresslocality20
postaladdress addresslocality eth20
addresslocality eth region20
httpschemaorg type jobposting20
context httpschemaorg type20
eth region addressregion20
years experience identifier19
experience identifier type19
local implementing partners18
array hiringorganization type15
region addressregion addis15
addressregion addis ababa15
addis ababa addresscountry15
ababa addresscountry eth15
employmenttype array hiringorganization15
members and local14
5 years experience13
health and nutrition13
235959 employmenttype array12
validthrough 2021-04-15 23595911
2021-04-15 235959 employmenttype11
3 days ago10
international medical corps10
ries engineering share9
duties and responsibilities9
engineering share company9
2 5 years8
level 2 58
mid level 28
experience mid level8
required experience mid8
nbspnbspnbspnbspnbspnbspnbspnbsp support oxfam7
ago alert hospital6
days ago alert6
monitoring and evaluation6
royal hotel apartment6
oxfam consortium members6
hotel apartment plc6
1 2 years6
train and support6
2 years experience6
level 1 26
junior level 16
experience junior level6
required experience junior6
name international medical6
day to day6
name ries engineering6
medical corps imc6
addis ababa today6
level 5 years5
also be responsible5
st gabriel general5
full time hiringorganization5
employmenttype full time5
time hiringorganization type5
senior level 55
plc context httpschemaorg5
implementing partners nbspnbspnbspnbspnbspnbspnbspnbsp5
support oxfam consortium5
implementing partners meal5
plc joblocation type5
experience senior level5
required experience senior5
ethiopian intellectual property4
intellectual property office4
community educational requirements4
gbv response project4
jobs in ethiopia4
years and above4
out of which4
ago ethiopian intellectual4
name royal hotel4
du monde -france4
mdecins du monde4
otp and sc4
addis ababa nbsp4
days ago ethiopian4
degree in accounting4
educational requirements qualifications4
region addressregion tigray4
addressregion tigray addresscountry4
tigray addresscountry eth4
finance unilever future4
gabriel general hospital4
marketing and sales4
name the talent4
health poverty action4
235959 employmenttype full4
oxfam great britain4
support community-based volunteer3
year ngo experience3
one year ngo3
which one year3
nbspnbspnbspnbspnbspnbspnbspnbsp at least3
registrationpracticing license nbspnbspnbspnbspnbspnbspnbspnbsp3
valid registrationpracticing license3
nbspnbspnbspnbspnbspnbspnbspnbsp college diplomadegree3
requirements nbspnbspnbspnbspnbspnbspnbspnbsp college3
educational requirements nbspnbspnbspnbspnbspnbspnbspnbsp3
strengthening of early3
community-based volunteer health3
health bureaus nbspnbspnbspnbspnbspnbspnbspnbsp3
health care issues3
preventative health care3
early referrals mechanism3
nutrition and preventative3
creation on nutrition3
mechanisms between community3
promotion of awareness3
planning and promotion3
nbspnbspnbspnbspnbspnbspnbspnbsp conduct planning3
woreda health bureaus3
volunteer health workers3
propertyvalue name international3
today ries engineering3
corps imc value3
share company value3
agro mechanics agricultural3
linkages and coordination3
mechanics agricultural mechanization3
mechanization or related3
simpler technology plc3
company joblocation type3
share company joblocation3
organization name ries3
370443 dateposted 2021-04-053
plc addis ababa3
value 370443 dateposted3
company value 3704433
propertyvalue name ries3
imc value 4863
company context httpschemaorg3
share company context3
ababa nbsp 032620213
years of experience3
maternal and child3
corps joblocation type3
medical corps joblocation3
organization name international3
000000 employmenttype array3
2021-04-14 000000 employmenttype3
validthrough 2021-04-14 0000003
486 dateposted 2021-04-053
value 486 dateposted3
coordination mechanisms between3
have an account3
strengthening of linkages3
addition the position3
imc context httpschemaorg3
position holder shall3
charge of technical3
technical quality implementation3
implementation and delivery3
mainly be responsible3
holder is also3
today international medical3
expected to provide3
provide supervision technical3
supervision technical assistance3
assistance and capacity3
building to health3
workers and health3
corps imc context3
plan and implement3
health facilities shehe3
amhara and afar3
massida solution plc3
up to date3
above work experience3
skills required experience3
validthrough 2021-04-12 2359593
2021-04-12 235959 employmenttype3
including the one3
prevention and response3
nbspnbspnbspnbspnbspnbspnbspnbsp work closely3
partners meal teams3
you will have3
finance and administrative3
poverty action ta3
educational requirements education3
response project officer3
workers in health3
implementation of mobile3
care at community3
coordinator and woreda3
weekly and monthly3
reports and share3
share with field3
field office health3
office health response3
health response coordinator3
woreda health offices3
provided services accordingly3
health offices specific3
offices specific duties3
responsibilities nbspnbspnbspnbspnbspnbspnbspnbsp improving3
nbspnbspnbspnbspnbspnbspnbspnbsp improving basic3
improving basic preventive3
basic preventive health3
preventive health care3
accordingly and compile3
all provided services3
nutrition services package3
integrated mobile health3
package as per3
per the standard3
standard supporting health3
supporting health facilities3
health facilities assigned3
assigned as integrated3
mobile health amp3
responsible for day3
health amp nutrition3
amp nutrition modality3
modality and daily3
dispensary and drug3
drug supply management3
supply management he3
he will also3
health extension workers3
addis ababa38
postaladdress addresslocality20
hiringorganization type20
type jobposting20
jobposting title20
educational requirements20
required experience20
identifier type20
type propertyvalue20
propertyvalue name20
dateposted 2021-04-0520
type organization20
context httpschemaorg20
joblocation type20
type place20
place address20
address type20
type postaladdress20
addresslocality eth20
eth region20
region addressregion20
addresscountry eth20
years experience20
httpschemaorg type20
organization name20
experience identifier19
local implementing18
implementing partners18
consortium members17
235959 employmenttype16
array hiringorganization15
employmenttype array15
ababa addresscountry15
addressregion addis15
5 years14
mobile health12
2021-04-15 23595911
nbspnbspnbspnbspnbspnbspnbspnbsp support11
validthrough 2021-04-1511
days ago10
3 days10
share company10
ries engineering10
international medical10
medical corps10
engineering share9
nbsp nbsp9
nutrition services9
hotel apartment8
royal hotel8
experience mid8
2 58
health facilities8
mid level8
health care8
level 28
1 jobs7
oxfam consortium7
support oxfam7
data collection7
field office7
2 years7
level 16
1 26
junior level6
ababa today6
project coordinator6
gbv response6
partners nbspnbspnbspnbspnbspnbspnbspnbsp6
work closely6
name ries6
program manager6
capacity building6
experience junior6
health workers6
woreda health6
nbspnbspnbspnbspnbspnbspnbspnbsp strengthening6
follow up6
nbspnbspnbspnbspnbspnbspnbspnbsp train6
name international6
position holder6
talent firm6
corps imc6
apartment plc6
ago alert6
2 jobs6
alert hospital6
full time5
two years5
plc context5
health education5
nbspnbspnbspnbspnbspnbspnbspnbsp work5
poverty action5
level 55
partners meal5
time hiringorganization5
gabriel general5
nbspnbspnbspnbspnbspnbspnbspnbsp ensure5
employmenttype full5
bsc degree5
work experience5
project nbspnbspnbspnbspnbspnbspnbspnbsp5
experience senior5
all times5
health services5
plc joblocation5
one year5
great britain5
st gabriel5
du monde5
plc value5
communication skills5
senior level5
nbsp 032620215
ezezu plc4
000000 employmenttype4
bachelors degree4
mdecins du4
validthrough 2021-04-144
health poverty4
health limited4
response project4
monde -france4
zone 14
ensure all4
child health4
public health4
community educational4
nbspnbspnbspnbspnbspnbspnbspnbsp conduct4
requirements qualifications4
meal officer4
unilever future4
meal team4
agco products4
oxfam great4
solution plc4
program quality4
ago ethiopian4
specific duties4
nbsp responsible4
name royal4
jobs 94
amp learning4
carries out4
business developer4
our client4
nbspnbspnbspnbspnbspnbspnbspnbsp provide4
general hospital4
ababa nbsp4
finance unilever4
tigray addresscountry4
addressregion tigray4
related field4
ethiopian intellectual4
intellectual property4
guidelines nbspnbspnbspnbspnbspnbspnbspnbsp4
name unilever4
quality amp4
property office4
view all4
license nbspnbspnbspnbspnbspnbspnbspnbsp3
millennium hall3
college diplomadegree3
field out3
registrationpracticing license3
requirements nbspnbspnbspnbspnbspnbspnbspnbsp3
training requirements3
valid registrationpracticing3
care issues3
nbspnbspnbspnbspnbspnbspnbspnbsp college3
community-based volunteer3
preventative health3
health bureaus3
community level3
emphasis health3
services nbspnbspnbspnbspnbspnbspnbspnbsp3
plc addis3
coordination mechanisms3
mechanisms between3
between community3
bureaus nbspnbspnbspnbspnbspnbspnbspnbsp3
awareness creation3
early referrals3
referrals mechanism3
3 jobs3
support community-based3
volunteer health3
community component3
training schedule3
conduct planning3
which one3
youth empowerment3
year ngo3
value 3704433
carry out3
nbsp preparing3
nbsp ensures3
his supervisor3
company value3
hospital has3
370443 dateposted3
company context3
basic preventive3
head nurse3
loan applications3
company joblocation3
loan associate3
technology plc3
nbsp process3
supervisor nbsp3
ngo experience3
2021-04-14 0000003
nbspnbspnbspnbspnbspnbspnbspnbsp experienced3
imc value3
value 4863
climate change3
simpler technology3
486 dateposted3
program areas3
agro mechanics3
corps joblocation3
mhnt -nurse3
new born3
today ries3
related fields3
agricultural mechanization3
mechanics agricultural3
preventive health3
login register3
improving basic3
field nbspnbspnbspnbspnbspnbspnbspnbsp3
tigray response3
monitoring evaluation3
meal framework3
technical support3
meal teams3
team nbspnbspnbspnbspnbspnbspnbspnbsp3
meal officers3
field team3
perform other3
more than3
oxfam program3
main duties3
nbspnbspnbspnbspnbspnbspnbspto manage3
evaluation officer3
other related3
administrative assistant3
action ta3
bank statements3
requirements education3
similar role3
not limited3
afar region3
already have3
social sciences3
account login3
ethiopia jobs3
government jobs3
latest jobs3
jobs 73
jobs 13
jobs 103
human resource3
jobs 43
ethiomap map3
roving meal3
padding 0px3
position absolute3
logistics sector3
massida solution3
above work3
excellent communication3
skills required3
validthrough 2021-04-123
2021-04-12 2359593
project officer3
3 years3
nbspnbspnbspnbspnbspnbspnbspnbsp improving3
all provided3
integrated mobile3
health amp3
amp nutrition3
nutrition modality3
daily dispensary3
drug supply3
supply management3
management he3
day documentation3
provided services3
supporting health3
services accordingly3
compile weekly3
monthly reports3
office health3
health response3
response coordinator3
health offices3
offices specific3
responsibilities nbspnbspnbspnbspnbspnbspnbspnbsp3
facilities assigned3
standard supporting3
peer education3
technical quality3
gbv officer3
project team3
gbv survivors3
outreach workers3
outreach worker3
mhnt- medical3
today international3
imc context3
holder shall3
quality implementation3
services package3
assigned woreda3
day implementation3
also expected3
provide supervision3
supervision technical3
technical assistance3
health extension3
extension workers3
facilities shehe3
daily implementation3
tigray today3
jobs114
type103
health92
nbspnbspnbspnbspnbspnbspnbspnbsp89
nbsp81
experience79
all54
project43
addis42
amp41
years41
name40
eth40
ababa38
support37
meal36
organization33
ensure32
level31
program30
requirements30
today30
field29
services29
oxfam29
other28
job28
work27
management27
data27
required26
local26
025
team24
title24
plc24
region24
value23
123
international23
implementation23
description22
quality22
you21
training21
partners21
finance21
company21
address21
ethiopia21
nutrition21
sales21
context21
propertyvalue20
validthrough20
identifier20
jobposting20
including20
dateposted20
httpschemaorg20
members20
2021-04-0520
postaladdress20
addresslocality20
addressregion20
skills20
place20
addresscountry20
joblocation20
employmenttype20
responsible20
provide20
educational20
hiringorganization20
consortium19
implementing19
medical19
219
response19
information19
officer18
tigray18
gbv18
manager18
learning18
business18
share18
reports17
office17
reporting17
monitoring17
activities17
316
community16
degree16
416
delivery15
array15
out15
related15
loan15
development15
time15
hotel15
accounting14
position14
minimum14
duties14
evaluation14
hospital14
technical14
workers14
top14
one14
day13
outreach13
left13
planning13
monthly13
staff13
engineering13
education13
projects12
service12
new12
mobile12
unilever12
teams12
parts12
holder12
communication12
line12
responsibilities12
if11
0px11
nbspnbspnbspnbspnbspnbspnbspto11
up11
our11
2021-04-1511
assigned11
order11
daily11
under11
tools11
corps11
report11
coordinator11
post11
per10
woreda10
agco10
have10
their10
which10
ries10
days10
ago10
care10
relevant10
manage9
afar9
monitor9
process9
financial9
register9
also9
standards9
programme9
customer9
his9
technology9
ngo9
children9
bank9
role8
referral8
senior8
timely8
junior8
train8
basic8
least8
accountability8
different8
full8
guidelines8
mid8
plan8
review8
based8
we8
collection8
distribution8
function8
royal8
marketing8
logistics8
youth8
apartment8
assist8
alert8
preparing8
sc8
otp8
facilities8
provided7
year7
limited7
conduct7
strong7
general7
supervision7
payment7
client7
background7
coordination7
capacity7
documents7
maintain7
gender7
department7
annual7
agricultural7
payments7
talent7
social7
contract7
any7
each7
child7
follow7
sector6
mdm6
us6
implement6
56
employers6
insurance6
national6
internal6
assistant6
procedures6
customers6
view6
people6
prevention6
protection6
over6
humanitarian6
closely6
design6
gabriel6
two6
ethiomap6
imc6
analysis6
excellent6
firm6
66
like6
develop6
areas6
times6
bsc6
create6
your6
conditions6
professional6
strengthening6
submit6
products6
next6
knowledge6
supervisor6
both6
arrival6
supply6
login6
mechanism6
working6
understanding6
action6
not6
detail6
facilitate6
framework6
building6
implemented5
coordinate5
latest5
find5
75
evaluations5
lead5
front5
officers5
necessary5
bachelors5
safety5
rights5
well5
essential5
qualifications5
better5
032620215
search5
major5
tax5
collect5
supervise5
objectives5
between5
bole5
applications5
manner5
good5
now5
etc5
already5
compile5
strengthen5
85
specific5
st5
nikat5
ethiopian5
clerk5
preferred5
massida5
extension5
possible5
solution5
fsws5
license5
britain5
great5
peer5
du5
change5
nurse5
date5
weekly5
performance5
needed5
close5
mhnt-5
he5
promotion5
best5
shehe5
monde5
expected5
system5
documentation5
head5
95
environment5
poverty5
legal5
supporting5
105
employment5
survivors4
global4
mdecins4
experienced4
administrative4
component4
underwriting4
mainly4
fsw4
sessions4
accurate4
more4
carries4
appropriate4
future4
its4
ability4
emphasis4
public4
software4
perform4
accordingly4
accountant4
cv4
community-based4
traveler4
apprenticeship4
maternal4
machine4
free4
fields4
against4
statements4
anppcan4
credit4
safe4
-france4
0000004
proper4
according4
files4
zone4
5x4
items4
nutritional4
association4
drugs4
integrated4
improving4
initiative4
ezezu4
awareness4
2021-04-144
within4
issues4
ensures4
similar4
available4
prepare4
four4
consultation4
events4
transporters4
vulnerable4
guidance4
human4
developer4
economics4
early4
case4
contact4
impact4
114
admin4
schedule4
location4
number4
truck4
before4
has4
systems4
key4
travel4
invoice4
package4
family4
update4
amhara4
tracker4
screening4
property4
successful4
email4
through4
security4
should4
intellectual4
sciences4
above4
government4
cash4
tasks4
get4
once4
using4
terms4
none4
companies4
employer4
way4
ensuring4
duty4
var4
principles4
complaints4
clients4
high4
else4
compliance4
operations4
083
model3
follow-up3
memo3
computer3
hews3
pdi3
absolute3
volunteer3
activity3
product3
diploma3
supplied3
nursing3
director3
padding3
mhnt3
-nurse3
targets3
they3
registrationpracticing3
valid3
establish3
diplomadegree3
into3
college3
market3
born3
preventative3
creation3
properly3
website3
123
provision3
identify3
here3
carry3
133
agro3
mechanics3
mechanization3
recruitersidebarcssright3
account3
empowerment3
climate3
hivaids3
budget3
receptionist3
help3
width3
workshop3
millennium3
hall3
stay3
guests3
rooms3
search-panel3
practical3
advanced3
advice3
career3
tips3
clean3
handling3
map3
updated3
document3
oromia3
original3
warranty3
import3
very3
written3
143
associate3
simpler3
research3
uw3
category3
resource3
ms3
instructions3
plus3
153
administration3
healthcare3
deliver3
equipment3
agriculture3
disassembled3
loans3
guideline3
referrals3
assessments3
english3
skill3
managers3
echo3
practices3
network3
donor3
leaders3
surveys3
programs3
effective3
nbspnbsp3
programmes3
but3
ta3
mission3
include3
achieve3
established3
currently3
consistent3
vouchers3
approved3
enquires3
main3
uk3
assure3
protocol3
adhere3
responsibility3
area3
than3
decisions3
heart3
current3
platforms3
across3
mentor3
studies3
reflection3
collecting3
processes3
quarterly3
feedback3
needs3
corporate3
evaluate3
drive3
them3
workshops3
online3
directly3
dbs3
bureaus3
suppliers3
materials3
immediately3
week3
transporter3
shall3
charge3
operation3
such3
eg3
addition3
assistance3
standard3
site3
modality3
dispensary3
drug3
companys3
mothers3
relations3
offices3
preventive3
meet3
linkages3
mechanisms3
worker3
warehouse3
banks3
functional3
screened3
can3
candidates3
non-governmental3
since3
focused3
sex3
engage3
roving3
access3
2021-04-123
copy3
guiding3
first3
done3
approval3
check3
invoices3
verify3
balance3
accuracy3
understand3
pss3
record3
true3

Who hosts Ethiojobs.net?

Ethiojobs.net Hosting Provider Information

Hosted IP Address:96.30.55.153
Hosted Hostname:server.ethiojobs.net
Service Provider:Cogswell Enterprises Inc.
Hosted Country:United StatesUS
Location Latitude:42.7348
Location Longitude:-84.6245
Webserver Software:LiteSpeed

Is "Cogswell Enterprises Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Cogswell Enterprises Inc.
0.0378%

HTTP Header Analysis for Ethiojobs.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Content-Type: text/html;charset=utf-8
Vary: Accept-Encoding,User-Agent,User-Agent,User-Agent
Transfer-Encoding: chunked
Content-Encoding: gzip
Date: Mon, 05 Apr 2021 19:21:13 GMT
Server: LiteSpeed
Access-Control-Allow-Origin: *
Access-Control-Allow-Headers: origin, x-requested-with, content-type
Access-Control-Allow-Methods: GET, OPTIONS
Alt-Svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000

Ethiojobs.net Domain Nameserver Information

HostIP AddressCountry
ns35.domaincontrol.com 97.74.107.18
ns36.domaincontrol.com 173.201.75.18


Need to find out who hosts Ethiojobs.net?


Domain Registration (WhoIs) information for Ethiojobs.net

 Domain Name: ETHIOJOBS.NET
Registry Domain ID: 90575794_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-02-08T07:29:57Z
Creation Date: 2002-09-24T15:02:39Z
Registry Expiry Date: 2022-09-24T15:04:08Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS35.DOMAINCONTROL.COM
Name Server: NS36.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-04-05T19:21:05Z

Websites with Similar Names

Ethio-arise.org
403 Forbidden
Ethio-boutic.net
Register.ch Parkpage
Ethio-cap.com
African Asset Finance Company - Home
Ethio-capital.com
African Asset Finance Company - Home
Ethio-cgfb.com
Ethio Lease - Home
Ethio-eco-trekking.com
Ethio Eco Trekking | Experience Ethiopian wonders
Ethio-fincorp.com
African Asset Finance Company - Home

Recently Updated Websites

Globalproducciones.com.mx (9 minutes 10 seconds ago.)Goldgrambars.com (9 minutes 11 seconds ago.)Labelledchaos.com (9 minutes 14 seconds ago.)Bulkwholesaleflowers.com (9 minutes 14 seconds ago.)Chamberlaingig.com (9 minutes 15 seconds ago.)3dfasttrack.com (9 minutes 21 seconds ago.)Stoneypet.com (9 minutes 21 seconds ago.)Aladinnhealth.com (9 minutes 25 seconds ago.)Rapitori.ro (9 minutes 30 seconds ago.)Nookieschicago.com (9 minutes 31 seconds ago.)Procoman.com (9 minutes 35 seconds ago.)Responsive7.online (9 minutes 39 seconds ago.)Goesse.com (9 minutes 39 seconds ago.)Copystars.com (9 minutes 42 seconds ago.)Tasemtempo.com (9 minutes 44 seconds ago.)Fjrensheng.com (9 minutes 45 seconds ago.)Etlassociates.com (9 minutes 45 seconds ago.)Pebblebeachmarketing.com (9 minutes 48 seconds ago.)Wallpapret.com (9 minutes 49 seconds ago.)Wmcity.ru (9 minutes 51 seconds ago.)Vanilla-scented.com (9 minutes 57 seconds ago.)Kyledwilliams.com (9 minutes 57 seconds ago.)Byslogistics.com (9 minutes 57 seconds ago.)Shoemegorgeous.com (10 minutes 4 seconds ago.)Freebirdsmoto.com (10 minutes 5 seconds ago.)Hiltonauctioneer.com (10 minutes 9 seconds ago.)Headbahamas.com (10 minutes 13 seconds ago.)Putrabhumiphala.com (10 minutes 16 seconds ago.)Bharatrajsaya.com (10 minutes 22 seconds ago.)Egizz.com (10 minutes 22 seconds ago.)

Recently Searched Keywords

quottagnamequot (1 second ago.)chania rent car (1 second ago.)2019guru0 comments (1 second ago.)酷9号外贸成衣批发 (2 seconds ago.)tics (2 seconds ago.)--background-sizeauto important (3 seconds ago.)�¹���������������¹� (4 seconds ago.)66方半挂散装饲料运输车 (7 seconds ago.)erbrains (7 seconds ago.)beranda youtube (7 seconds ago.)legacy movie (9 seconds ago.)slick-prev iconbefore (10 seconds ago.)epack hygiene youtube (10 seconds ago.)9658160 april (11 seconds ago.)-3px (12 seconds ago.)dayton (13 seconds ago.)paix (14 seconds ago.)foxit pdf printer (17 seconds ago.)tmpbutton-82675 (17 seconds ago.)w polsce brakuje lekarzy. kolejnych zabiera covid (18 seconds ago.)border 2px solid (19 seconds ago.)divorce mediation (20 seconds ago.)compare hotels (23 seconds ago.)alliconicontypeplayallthumbnailoverlaynowplayingrenderertextrunstextnow playingviewplaylisttextrunstextview full (23 seconds ago.)94 94 06 (24 seconds ago.)wersja turbo s (24 seconds ago.)тату (25 seconds ago.)byk il (26 seconds ago.)guante masajeador removedor de pelo para gatos y perros (27 seconds ago.)copyright © 2020 digimedia.com, l.p. (29 seconds ago.)