Euphony.be Favicon Euphony.be

Euphony.be Website Thumbnail
Checking...
Bienvenue chez Orange
Low trust score
Add a review Change category Claim this site
Orange propose des solutions de téléphonie mobile, d’internet mobile, de télévision numérique et d’internet fixe. Vous pouvez choisir un abonnement de GSM, une carte prépayée, un GSM combiné avec abonnement ou profiter de nos nombreuses promotions.


Domain summary

Domain label
euphony
Domain extension
be
Domain registered:
2000-12-12
Domain updated:
2020-09-11
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is euphony.be ranked relative to other sites:

Percentage of visits to euphony.be from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Euphony.be registered?
A: Euphony.be was registered 19 years, 9 months, 2 weeks, 21 hours, 39 minutes, 12 seconds ago on Tuesday, December 12, 2000.
Q: When was the WHOIS for Euphony.be last updated?
A: The WHOIS entry was last updated 2 weeks, 1 day, 21 hours, 39 minutes, 12 seconds ago on Friday, September 11, 2020.
Q: What are Euphony.be's nameservers?
A: DNS for Euphony.be is provided by the following nameservers:
  • ns4.combell.net
  • ns3.combell.net
  • www.dnsbelgium.be
Q: Who is the registrar for the Euphony.be domain?
A: The domain has been registered at DNS Belgium.
Q: What is the traffic rank for Euphony.be?
A: Euphony.be has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Euphony.be each day?
A: Euphony.be receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Euphony.be resolve to?
A: Euphony.be resolves to the IPv4 address 212.65.63.184.
Q: In what country are Euphony.be servers located in?
A: Euphony.be has servers located in the Belgium.
Q: What webserver software does Euphony.be use?
A: Euphony.be is powered by Apache webserver.
Q: Who hosts Euphony.be?
A: Euphony.be is hosted by Mobistar SA in Belgium.
Q: How much is Euphony.be worth?
A: Euphony.be has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Euphony.be?

Euphony.be Hosting Provider Information

Hosted IP Address:212.65.63.184
Hosted Hostname:www.smartsn.be
Service Provider:Mobistar SA
Hosted Country:BelgiumBE
Location Latitude:50.8509
Location Longitude:4.3447
Webserver Software:Apache

Is "Mobistar SA" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Euphony.be

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Fri, 11 Sep 2020 05:06:35 GMT
Server: Apache
Location: https://www.orange.be/
Content-Length: 230
Content-Type: text/html; charset=iso-8859-1

Euphony.be Domain Nameserver Information

HostIP AddressCountry
ns4.combell.net 86.39.202.67
ns3.combell.net 83.217.73.172
www.dnsbelgium.be 107.154.248.139


Need to find out who hosts Euphony.be?


WhoIs information for Euphony.be

 % .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%

Domain: euphony.be
Status: NOT AVAILABLE
Registered: Tue Dec 12 2000

Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.

Registrar Technical Contacts:
Organisation: Orange
Language: en
Phone: +32.27459207
Fax: +32.27459461

Organisation: Orange Tech Mahindra
Language: en
Phone: +32.27457917
Fax: +32.27458890

Registrar:
Name: Orange SA
Website: http://www.orange.be

Nameservers:
ns4.combell.net
ns3.combell.net

Keys:

Flags:

Please visit www.dnsbelgium.be for more info.

Euphony.be Free SEO Report

Website Inpage Analysis for Euphony.be

H1 Headings

0 :

H2 Headings

7 :
  1. Best deal !
  2. Smartphones et GSM
  3. Comment pouvons-nous vous aider ?
  4. Produits et services
  5. Orange Thank You
  6. Pourquoi choisir Orange?
  7. Blog Orange

H3 Headings

13 :
  1. L’iPhone attendu, à prix inattendu
  2. L’iPhone attendu, à prix inattendu
  3. Notre sélection pour vous
  4. Bienvenue chez Orange
  5. Pas de surprises
  6. Toujours sans souci
  7. Libre de choisir
  8. Il y a toujours une offre faite pour vous
  9. Votre fidélité récompensée
  10. Découvrez l’univers d’Orange
  11. Nouvel iPhone 12 en Belgique : ce qu’on sait déjà et les dernières rumeurs
  12. Nouveau Samsung Galaxy S20, S20+ et S20 Ultra : quel modèle choisir ?
  13. Nouvel iPhone SE : tout ce que vous devez savoir

H4 Headings

6 :
  1. Combinez mobile, internet et TV au meilleur prix.
  2. Promo web : - 50 % sur votre abonnement pendant 3 mois.
  3. PROMO : Faites le plein de data pour 15 €
  4. Un réseau au top 
  5. Les meilleurs prix 
  6. Un service de qualité 

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

96:
  1. No text
    http://euphony.be/fr/
  2. No text
    http://euphony.be/fr/shops
  3. FR
    http://euphony.be/fr
  4. NL
    http://euphony.be/nl
  5. Love Duo Pro Internet + Mobile
    http://euphony.be/fr/produits-et-services/internet-tv-mobile/nouveau-client?TP=BI_00_00_00_00_00
  6. Love Trio Pro TV + Internet + Mobile
    http://euphony.be/fr/produits-et-services/internet-tv-mobile/nouveau-client?TP=BI_00_00_00_00_TV
  7. Options Love
    http://euphony.be/fr/options-et-services/internet-et-tv
  8. Chaines TV
    http://euphony.be/fr/options-et-services/internet-et-tv/orange-tv-chaines
  9. Orange football
    http://euphony.be/fr/options-et-services/orange-football
  10. Pass Streaming Eleven
    http://euphony.be/fr/options-et-services/eleven
  11. Téléphone fixe
    http://euphony.be/fr/produits-et-services/telephone-fixe
  12. Orange TV app
    http://euphony.be/fr/orange-tv-app
  13. Installation et support Love
    http://euphony.be/fr/options-et-services/services-internet-et-tv
  14. Déménager
    http://euphony.be/fr/produits-et-services/internet-tv-mobile/demenagement-love
  15. No text
    http://euphony.be/
  16. Abonnements GSM
    http://euphony.be/fr/produits-et-services/abonnements-gsm
  17. Cartes prépayées Tempo
    http://euphony.be/fr/produits-et-services/cartes-prepayees
  18. Orange pour les Pro
    http://euphony.be/fr/independants/orange-pour-professionnels
  19. Options abonnements GSM
    http://euphony.be/fr/options-et-services/abonnements-gsm/options
  20. Options cartes prépayées
    http://euphony.be/fr/options-et-services/cartes-prepayees/options
  21. Roaming & international
    http://euphony.be/fr/options-et-services/international
  22. My Orange app
    http://euphony.be/fr/options-et-services/myorange
  23. Orange Thank You
    http://euphony.be/fr/options-et-services/orange-thank-you
  24. Réseau Orange
    http://euphony.be/fr/reseau
  25. Étalement de paiement
    http://euphony.be/fr/etalement-de-paiement
  26. Offres internet
    http://euphony.be/fr/produits-et-services/internet
  27. Internet + Mobile
    http://euphony.be/fr/produits-et-services/internet-tv-mobile/nouveau-client?TP=BI_00_00_00_00_00
  28. TV + Internet + Mobile
    http://euphony.be/fr/produits-et-services/internet-tv-mobile/nouveau-client?TP=BI_00_00_00_00_TV
  29. Flybox
    http://euphony.be/fr/produits-et-services/flybox
  30. Carte Sim pour tablette
    http://euphony.be/fr/options-et-services/abonnements-gsm/options#/gerer-votre-data
  31. Internet Boost
    http://euphony.be/fr/options-et-services/internet-boost
  32. Internet speedtest
    http://euphony.be/fr/speedtest
  33. Réseau Orange
    http://euphony.be/fr/reseau
  34. Options smartphone
    http://euphony.be/fr/options-et-services/gsm-et-smartphone
  35. Configuration en ligne
    http://euphony.be/fr/options-et-services/configuration-en-ligne
  36. Reprise ancien GSM
    http://euphony.be/fr/options-et-services/gsm-et-smartphone/reprise-de-votre-gsm
  37. Réparation GSM
    http://euphony.be/fr/options-et-services/reparer-votre-gsm
  38. Assurance
    http://euphony.be/fr/options-et-services/assurance-de-votre-gsm-ou-tablette
  39. Promotions
    http://euphony.be/fr/promo
  40. Blog
    http://euphony.be/fr/blog/list
  41. Support
    http://euphony.be/fr/support
  42. Recharger
    http://euphony.be/fr/recharger-en-ligne
  43. Particuliers
    http://euphony.be/fr
  44. Indépendants
    http://euphony.be/fr/independants
  45. Shops
    http://euphony.be/fr/shops
  46. Promos
    http://euphony.be/fr/promo
  47. Packs
    http://euphony.be/fr/produits-et-services/internet-tv-mobile/nouveau-client?TP=BB_00_00_00_00_00
  48. Abonnements
    http://euphony.be/fr/produits-et-services/abonnements-gsm
  49. Cartes prépayées
    http://euphony.be/fr/produits-et-services/cartes-prepayees
  50. Internet
    http://euphony.be/fr/produits-et-services/internet
  51. contrôler votre consommation
    http://euphony.be/fr/support/votre-consommation/comment-controler-votre-consommation
  52. recharger une carte prépayée
    http://euphony.be/fr/options-et-services/recharger-en-ligne
  53. découvrir vos avantages Orange Thank You
    http://euphony.be/fr/options-et-services/orange-thank-you
  54. configurer votre GSM
    http://euphony.be/fr/options-et-services/configuration-en-ligne
  55. changer de plan tarifaire ou ajouter une option
    http://euphony.be/fr/support/telephonie-mobile/modifier-votre-abonnement
  56. 1 Pas de surprises Des frais supplémentaires qui apparaissent sans prévenir sur votre facture ? On intervient !
    http://euphony.be/node/211431#geen-verrassingen
  57. 2 Toujours sans souci Pas de réseau ou tout d'un coup plus de data ? On intervient !
    http://euphony.be/node/211431#gewoon-zijn
  58. 3 Libre de choisir Payer pour des produits ou services que vous n'utilisez pas ? On intervient !
    http://euphony.be/node/211431#vrij-kiezen
  59. Découvrir Orange Thank You
    http://euphony.be/fr/options-et-services/orange-thank-you
  60. Un réseau au top 
    http://euphony.be/fr/reseau
  61. En savoir plus
    http://euphony.be/fr/reseau
  62. Les meilleurs prix 
    http://euphony.be/fr/homepage
  63. En savoir plus
    http://euphony.be/fr/promo
  64. Un service de qualité 
    http://euphony.be/fr/options-et-services/avantages-et-services-inclus
  65. En savoir plus
    http://euphony.be/fr/options-et-services/avantages-et-services-inclus
  66. Tous les articles
    http://euphony.be/fr/blog/list
  67. No text
    http://euphony.be/fr/blog/rumeurs-iphone-12-2020-belgique
  68. Nouvel iPhone 12 en Belgique : ce qu’on sait déjà et les dernières rumeurs
    http://euphony.be/fr/blog/rumeurs-iphone-12-2020-belgique
  69. No text
    http://euphony.be/fr/blog/samsung-galaxy-S20-Plus-Ultra-quel-modele-choisir
  70. Nouveau Samsung Galaxy S20, S20+ et S20 Ultra : quel modèle choisir ?
    http://euphony.be/fr/blog/samsung-galaxy-S20-Plus-Ultra-quel-modele-choisir
  71. No text
    http://euphony.be/fr/blog/iphone-se2-2020-tout-savoir
  72. Nouvel iPhone SE : tout ce que vous devez savoir
    http://euphony.be/fr/blog/iphone-se2-2020-tout-savoir
  73. S’inscrire à la newsletter
    http://euphony.be/fr/newsletters
  74. No text
    http://euphony.be/fr/facebook
  75. No text
    http://euphony.be/fr/twitter
  76. No text
    http://euphony.be/fr/instagram
  77. No text
    http://euphony.be/fr/linkedin
  78. No text
    http://euphony.be/fr/youtube
  79. No text
    http://euphony.be/fr/newsletters
  80. Recharger votre carte
    http://euphony.be/fr/recharger-en-ligne
  81. Identifier votre carte
    http://euphony.be/fr/produits-et-services/cartes-prepayees/identification-de-votre-carte-prepayee
  82. Tarifs internationaux
    http://euphony.be/fr/options-et-services/international
  83. S'inscrire à l'Espace client
    http://euphony.be/fr/e-services/enregistrement
  84. Livraison
    http://euphony.be/fr/support/appareils/livraison
  85. Code PIN/PUK
    http://euphony.be/fr/support/telephonie-mobile/codes-pin-et-puk
  86. GSM perdu/volé
    http://euphony.be/fr/support/appareils/vol-ou-perte-de-votre-gsm-ou-tablette
  87. Réparer votre GSM
    http://euphony.be/fr/support/appareils/reparer-votre-gsm-ou-votre-tablette
  88. Suivre votre consommation
    http://euphony.be/fr/support/facturation-et-consommation/controler-votre-consommation
  89. Réseau
    http://euphony.be/fr/reseau
  90. Conditions générales
    http://euphony.be/fr/conditions-generales
  91. Anciens plans tarifaires
    http://euphony.be/fr/produits-et-services/anciens-plans-tarifaires
  92. Tarif social
    http://euphony.be/fr/tariff-social
  93. Gestion des cookies
    http://euphony.be/fr/cookies
  94. Contactez-nous
    http://euphony.be/fr/contact
  95. Localiser nos shops
    http://euphony.be/fr/shops
  96. Configurer votre GSM
    http://euphony.be/fr/options-et-services/configuration-en-ligne

Links - Internal (nofollow)

0:

Links - Outbound

56:
  1. No text
    https://e-services.orange.be/fr
  2. Espace client
    https://e-services.orange.be/fr
  3. No text
    https://eshop.orange.be/fr/checkout/cart/
  4. Smartphones avec abonnement
    https://eshop.orange.be/fr/appareils/smartphones-gsm
  5. Smartphones et GSM
    https://eshop.orange.be/fr/appareils/smartphones-gsm
  6. Accessoires
    https://eshop.orange.be/fr/appareils/accessoires
  7. Objets connectés
    https://eshop.orange.be/fr/appareils/objets-connectes
  8. Tablettes
    https://eshop.orange.be/fr/appareils/tablettes
  9. Modems
    https://eshop.orange.be/fr/appareils/modems
  10. Déstockage
    https://eshop.orange.be/fr/appareils/smart-phone-outlet
  11. Espace Client
    https://e-services.orange.be/fr
  12. Communauté
    https://community.orange.be/t5/Orange-Tribe/ct-p/francais
  13. Entreprises
    https://business.orange.be/fr
  14. La société Orange
    https://corporate.orange.be/fr
  15. Smartphones
    https://eshop.orange.be/fr/appareils/smartphones-gsm
  16. Je craque
    https://eshop.orange.be/fr/apple-iphone-se
  17. Tous les GSM
    https://eshop.orange.be/fr/appareils/smartphones-gsm
  18. No text
    https://eshop.orange.be/fr/huawei-p30-lite-new-edition
  19. Huawei P30 Lite New Edition 259,95 â‚¬ 1 â‚¬ avec Smart Data 1GB + Go Plus 214,83 â‚¬ 0,83 â‚¬ avec Smart Data 1GB + Go Plus Pro
    https://eshop.orange.be/fr/huawei-p30-lite-new-edition
  20. Commander
    https://eshop.orange.be/fr/huawei-p30-lite-new-edition
  21. No text
    https://eshop.orange.be/fr/xiaomi-mi-10-lite
  22. Xiaomi Mi 10 Lite 369,95 â‚¬ 1 â‚¬ avec Smart Data 1GB + Go Plus 305,74 â‚¬ 0,83 â‚¬ avec Smart Data 1GB + Go Plus Pro
    https://eshop.orange.be/fr/xiaomi-mi-10-lite
  23. Commander
    https://eshop.orange.be/fr/xiaomi-mi-10-lite
  24. No text
    https://eshop.orange.be/fr/samsung-galaxy-a51
  25. Samsung Galaxy A51 299,95 â‚¬ 1 â‚¬ avec Smart Data 1GB + Go Plus 247,89 â‚¬ 0,83 â‚¬ avec Smart Data 1GB + Go Plus Pro
    https://eshop.orange.be/fr/samsung-galaxy-a51
  26. Commander
    https://eshop.orange.be/fr/samsung-galaxy-a51
  27. No text
    https://eshop.orange.be/fr/galaxy-s20
  28. Samsung Galaxy S20 799,95 â‚¬ 499,95 â‚¬ avec Go Unlimited 661,12 â‚¬ 413,18 â‚¬ avec Go Unlimited Pro
    https://eshop.orange.be/fr/galaxy-s20
  29. Commander
    https://eshop.orange.be/fr/galaxy-s20
  30. consulter vos factures
    https://e-services.orange.be/fr/invoices
  31. No text
    https://www.orange.be/fr/produits-et-services/internet-tv-mobile
  32. Combinez mobile, internet et TV au meilleur prix.
    https://www.orange.be/fr/produits-et-services/internet-tv-mobile
  33. Découvrir
    https://www.orange.be/fr/produits-et-services/internet-tv-mobile
  34. No text
    https://www.orange.be/fr/produits-et-services/abonnements-gsm
  35. Promo web : - 50 % sur votre abonnement pendant 3 mois.
    https://www.orange.be/fr/produits-et-services/abonnements-gsm
  36. En profiter
    https://www.orange.be/fr/produits-et-services/abonnements-gsm
  37. No text
    https://www.orange.be/fr/produits-et-services/cartes-prepayees
  38. PROMO : Faites le plein de data pour 15 €
    https://www.orange.be/fr/produits-et-services/cartes-prepayees
  39. En savoir plus
    https://www.orange.be/fr/produits-et-services/cartes-prepayees
  40. No text
    https://community.orange.be/t5/Orange-Tribe/ct-p/francais
  41. Vos factures
    https://e-services.orange.be/fr/invoices
  42. Votre consommation
    https://e-services.orange.be/fr/overview
  43. Vos cadeaux
    https://e-services.orange.be/fr/surprise
  44. iPhone
    https://eshop.orange.be/fr/appareils/smartphones-gsm/iphone
  45. Samsung
    https://eshop.orange.be/fr/appareils/smartphones-gsm/samsung
  46. Huawei
    https://eshop.orange.be/fr/appareils/smartphones-gsm/huawei
  47. Xiaomi
    https://eshop.orange.be/fr/appareils/smartphones-gsm/xiaomi
  48. Orange pour tous
    https://corporate.orange.be/fr/responsabilit%C3%A9-soci%C3%A9tale/clients/inclusion-digitale
  49. La société Orange
    https://corporate.orange.be/fr
  50. Jobs
    https://corporate.orange.be/fr/jobs
  51. Solutions pour entreprises
    https://business.orange.be/fr
  52. Informations financières
    https://corporate.orange.be/fr/informations-financieres
  53. Coordonnées de l'entreprise
    https://corporate.orange.be/fr/contact
  54. Offres d'emploi
    https://corporate.orange.be/fr/ressources-humaines
  55. Vie privée
    https://corporate.orange.be/fr/vie-priv%C3%A9e
  56. Information Consommateurs
    https://corporate.orange.be/fr/informations-l%C3%A9gales

Links - Outbound (nofollow)

0:

Keyword Cloud for Euphony.be

90px2oldprice fontsize2s all easeinoutbannerpositioncenterpackstop 0ulflexdirectionnavdudisplay nonenormal displaycontactpoint telephone 500060pxdevicepricedisplay inlineblock0 herodevicesimportantdata 1gb20pxherodevices devicepriceurlhttpsb2cproductionsitebe80wkthrgjjkmzuip0netdnasslcomsitesb2cfilesbestdealsmicropngfontsizenewprice euro fontsizefielditems083nbsp avec smartfontsize 14pxscreen and maxwidthsamsung galaxyauclienttollfree availablelanguagefontweight normalimagetopcentertype contactpoint telephonefontsize 16pxnone10pxtextalign999999 fontweightconsommationcenter norepeat quicklinksbarhomebannerbestdealbackground urlhttpsb2cproductionsitebe80wkthrgjjkmzuip0netdnasslcomsitesb2cfilesbestdealsmicropng lefttousrseautextalign centerauto left autoorangenormal display blockdeviceff7900 position relativesmart data 1gboldprice herodevices deviceprice0 width 100votre gsmhpbanner backgroundeaseinoutoldprice14px lineheight 16pxbottom autodeviceimages bubblewrapperpredicateall easeinout16px lineheight 18pxfixselogo marginbottom40px 020px homebannerbestdealvariationfixedcenter centerhpbanner background urlhttpsb2cproductionsitebe80wkthrgjjkmzuip0netdnasslcomsitesb2cfilesbestdealsmicropngfloat nonelineargradientto rightmaxwidth 991pxcolor 999999 fontweightcenter norepeatvardeviceimgoubackgroundsize20px homebannerbestdealff7900 positionb2cglobalfooterinnerwrapper b2cglobalfootersocialvoir aussiherodevicesservice contactoptionherodevices deviceitemcontacttype customernormaldeviceprice newprice eurotransition 2seuro fontsize 25pxeuro fontsizeh3doublepostpaiddecimal positionnewprice decimal0homebannerbestdealvariation newprice decimaltextdecorationnorepeat transition allb2cglobalfootersocialcartesb2cglobalfooterfirstmaxwidthcontactoptiontransitioninitial fontsizecontacttype customer servicemarginbottom 0homebannerbestdealvariation newpriceleftcolor ff7900 positionb2cglobalfooterfirst b2cglobalfooterinnerwrapper b2cglobalfootersocialh2oldprice herodeviceswidth 100 margintopposition absolute topnewprice display initialposition absolutenewprice eurocolorprob2cglobalfootercontainer b2cglobalfooterfirst b2cglobalfooterinnerwrapperhpbanneravecbottomright 000000 000000all 2s easeinoutff7900fontsize 25pxoverflowstickyfixedbottom auto leftauto 30pxmaxwidth 767pxhomebannerbestdeal newprice decimalonly1nodelayercolumnsbannersliderblockhpsamsungtransition 2s allauto leftyouinlineblock verticalalign bottombackgroundscrollsmartphones et gsm16px lineheightthankcontent f135centeredslidescustomerdisplay initialnewprice fontsize5000 contacttype customerheightintervient14pxnorepeat quicklinksbar999999 fontweight normalofferpricesohopacks loveleft autob2cglobalfootersocial b2cglobalfooterlisttitledataurlhttpsb2cproductionsitebe80wkthrgjjkmzuip0netdnasslcomsitesb2cfilesbestdealsmicropng left6successuneorange thankminheightdeviceitemdisplay inlineblock verticalalignservicehomebannerbestdealvariationtextdecoration none2sdeviceprice oldprice herodevices083nbsp avectransition all 2sfontsize 26pxsmartphones etmeilleurnewprice displaymarginbottomsupportbtnlineheight 18pxmarginbottom 15pxlescontacttypedesnorepeat transitionahoverfielditemeven28pxaussipaddingtopmedia only000swiperpaginationbackgroundsize autofontsize 14px lineheightcontactpointpricenodecimalscenter center norepeatnewprice decimal positionhomebannerbestdeal newprice14px lineheightcolor 999999left 0000000 000000center norepeat transition26pxpaddingprevpricesohof135fontweightavec smart767pxherodevices deviceimageseurofontsize 16px lineheightonly screenherodevices deviceprice oldpricetransform2sb2cglobalfootercontainer b2cglobalfooterfirstspacebetweenposition relative1gb nbspgonbspplustelephone 5000smartphoneschoisirbubblewrappernorepeat lineargradienttoauto rightsolidswiperslidenorepeat lineargradientto rights20b2cglobalfooterinnerwrapper b2cglobalfootersocial b2cglobalfooterlisttitlenbspgonbspplusnewprice decimal herodevicesmobile25pxsavoir plus991pxservice contactoption tollfreevoirtopdocumentmargintop 10pxherodevices btncontactoption tollfree availablelanguageleft 0 widthinternet mobileappareilsreleasedvotrecontactpoint telephonebackground urlhttpsb2cproductionsitebe80wkthrgjjkmzuip0netdnasslcomsitesb2cfilesbestdealsmicropnghomebannerbestdealvariation oldprice fontsizeautoiphonegalaxyet gsmtpquicklinksbarlineargradientto right 000000promolineargradienttob2cglobalfooterfirst b2cglobalfooterinnerwrappertous lesb2cglobalfooterinnerwrapperlineheight 16pxfunction3quicklinksbar ahoverscreenselogocolor ff7900herodevices doubleavailablelanguagespanbeforeslidesperview000000customer servicetype contactpointwidth 100je craqueswiper14px herodevicesmargintop 20pxabonnements80pxnorepeat quicklinksbar ahoverherodevices deviceitemhoveravec smart data5000 contacttype100pxstickydisplay initial fontsizedecimalsverticalalign bottomcommaindexcartezindexmedia only screenindexcontactoption tollfreeinlineblock verticalalignblockvotre consommationswiperslideactivedata 1gb nbspgonbspplusordertype0pxall 2sthank youhomebannerbestdealvariation oldpriceb2cglobalfooterlisttitle5herodevices deviceprice newpriceherodevices deviceimages bubblewrapperabonnement1gbleft auto rightinlineblockwindow width2s all8displaygsmbackgroundsize auto 30pxdeviceimages50pxtransition allfielditems fielditemevenabsolute topetsmartabsolutefontsize 14px herodevicesdeviceitemhovermarginarticlenode219856130pxdeviceprice oldpricefloatfieldcontentinternetsavoirwindowcustomer service contactoptiontopoffset18pxprixhomebannerbestdealvariation h3voussmart datacraquedeviceprice newprice decimalcommunauteacutenorepeattelephone 5000 contacttypeinternet internet30pxbelgiquelovemedia screenplustop 10pxservicesdecimal herodevicesborderradiusoldprice fontsize 16pxpouroptionsmargintop1nbsp avec smart16px2s easeinoutinitialabeforeposition fixedjquerydocumentreadyfunction0 widthcontentvosh3 marginbottomwidth083nbsp4mediarechargerdisplay blockjquerythistextreplacerelativemarginright100 margintopdeviceprice newpricereturnsallorange thank youif5pxavec abonnementb2cglobalfootercontainertollfreetp fontsizejemarginbottom 20pxdecimal position absoluterightprepaidtelephoneminwidth15pxverticalalignnewprice40pxpashomebannerbestdeal h20 leftfontweight normal displaypaddingrightdecimal herodevices deviceprice7right 000000lineheightcommanderswipercontainer1nbsptvfielditemeven articlenode2198561nbsp avecdecimalpaddingleft

Longtail Keyword Density for Euphony.be

KeywordsOccurences
screen and max-width14
center center no-repeat12
hero-devices device-price new-price11
transition all 2s7
all 2s ease-in-out7
new-price euro font-size7
smart data 1gb6
avec smart data6
center no-repeat transition6
no-repeat transition all6
center no-repeat quicklinks-bar6
b2c-global-footer-container b2c-global-footer-first b2c-global-footer-inner-wrapper6
hero-devices device-price old-price5
background-size auto 30px5
999999 font-weight normal5
font-size 16px line-height5
color 999999 font-weight5
device-price new-price decimal5
no-repeat quicklinks-bar ahover5
position absolute top4
left auto right4
hero-devices device-images bubble-wrapper4
data 1gb nbspgonbspplus4
display inline-block vertical-align4
font-weight normal display4
normal display block4
euro font-size 25px4
orange thank you4
left 0 width4
b2c-global-footer-first b2c-global-footer-inner-wrapper b2c-global-footer-social4
0 width 1004
media only screen4
linear-gradientto right 0000003
083nbsp avec smart3
home-banner-best-deal-variation old-price font-size3
home-banner-best-deal-variation new-price decimal3
1nbsp avec smart3
contacttype customer service3
5000 contacttype customer3
telephone 5000 contacttype3
transition 2s all3
14px line-height 16px3
2s all ease-in-out3
contactpoint telephone 50003
type contactpoint telephone3
b2c-global-footer-inner-wrapper b2c-global-footer-social b2c-global-footer-list-title3
device-price old-price hero-devices3
old-price hero-devices device-price3
new-price decimal hero-devices3
decimal hero-devices device-price3
device-price new-price euro3
width 100 margin-top3
old-price font-size 16px3
font-size 14px line-height3
background urlhttpsb2cproductionsite-be80wkthrgjjkmzuip0netdna-sslcomsitesb2cfilesbest-deals-micropng left3
no-repeat linear-gradientto right3
inline-block vertical-align bottom3
new-price display initial3
display initial font-size3
color ff7900 position3
ff7900 position relative3
home-banner-best-deal new-price decimal3
smartphones et gsm3
new-price decimal position3
right 000000 0000003
decimal position absolute3
hp-banner background urlhttpsb2cproductionsite-be80wkthrgjjkmzuip0netdna-sslcomsitesb2cfilesbest-deals-micropng3
bottom auto left3
auto left auto3
16px line-height 18px3
contactoption tollfree availablelanguage3
service contactoption tollfree3
customer service contactoption3
font-size 14px hero-devices3
hero-devices device-price16
display block15
position relative13
hero-devices device-images12
center no-repeat12
center center12
media screen11
device-price new-price11
new-price decimal11
width 10010
font-size 16px9
field-itemeven articlenode-2198568
new-price euro7
euro font-size7
home-banner-best-deal-variation new-price7
transition all7
all 2s7
2s ease-in-out7
quicklinks-bar ahover7
home-banner-best-deal new-price7
no-repeat quicklinks-bar6
data 1gb6
avec smart6
no-repeat transition6
display inline-block6
font-size 14px6
old-price font-size6
background-size auto6
color ff79006
b2c-global-footer-container b2c-global-footer-first6
b2c-global-footer-first b2c-global-footer-inner-wrapper6
smart data6
auto 30px5
hero-devices device-item5
0 hero-devices5
text-decoration none5
0 width5
device-price old-price5
16px line-height5
margin-bottom 20px5
font-weight normal5
999999 font-weight5
color 9999995
text-align center5
20px home-banner-best-deal-variation5
display initial4
internet mobile4
font-size 25px4
auto right4
left auto4
se-logo margin-bottom4
inline-block vertical-align4
absolute top4
normal display4
position absolute4
tp font-size4
savoir plus4
1gb nbspgonbspplus4
top 04
voir aussi4
orange thank4
thank you4
content f1354
hero-devices double4
b2c-global-footer-inner-wrapper b2c-global-footer-social4
field-items field-itemeven4
device-images bubble-wrapper4
position fixed4
new-price font-size4
left 04
only screen4
media only4
hero-devices device-itemhover3
samsung galaxy3
14px line-height3
line-height 16px3
votre gsm3
margin-bottom 03
40px 03
votre consommation3
100 margin-top3
14px hero-devices3
hero-devices btn3
tous les3
1nbsp avec3
font-size 26px3
margin-top 20px3
top -10px3
decimal hero-devices3
home-banner-best-deal-variation h33
083nbsp avec3
margin-top 10px3
all ease-in-out3
home-banner-best-deal-variation old-price3
2s all3
transition 2s3
old-price hero-devices3
packs love3
h3 margin-bottom3
contactpoint telephone3
tollfree availablelanguage3
contactoption tollfree3
service contactoption3
customer service3
contacttype customer3
5000 contacttype3
telephone 50003
type contactpoint3
0 left3
display none3
b2c-global-footer-social b2c-global-footer-list-title3
margin-bottom 15px3
et gsm3
smartphones et3
internet internet3
avec abonnement3
max-width 991px3
window width3
max-width 767px3
float none3
line-height 18px3
auto left3
bottom auto3
decimal position3
ff7900 position3
initial font-size3
20px home-banner-best-deal3
vertical-align bottom3
je craque3
home-banner-best-deal h23
000000 0000003
right 0000003
linear-gradientto right3
no-repeat linear-gradientto3
urlhttpsb2cproductionsite-be80wkthrgjjkmzuip0netdna-sslcomsitesb2cfilesbest-deals-micropng left3
background urlhttpsb2cproductionsite-be80wkthrgjjkmzuip0netdna-sslcomsitesb2cfilesbest-deals-micropng3
hp-banner background3
new-price display3
hero-devices62
font-size39
var36
033
center32
display31
width31
background25
new-price25
home-banner-best-deal-variation23
line-height22
position21
auto21
home-banner-best-deal21
media20
margin-bottom20
max-width20
orange20
field-itemeven17
height16
device-price16
block16
color16
20px15
internet15
function15
screen15
no-repeat15
left14
avec13
gsm13
top13
votre13
relative13
112
all12
quicklinks-bar12
none12
device-images12
16px12
margin-top12
decimal11
30px11
mobile10
old-price10
important10
ease-in-out10
2s10
transition10
et10
content9
h39
right8
smartphones8
data8
ff79008
articlenode-2198568
pour8
text-align7
ahover7
packs7
love7
plus7
margin7
les7
min-height7
10px7
euro7
60px7
z-index7
bottom7
if6
vous6
14px6
smart6
40px6
initial6
1gb6
des6
inline-block6
0000006
prevpricesoho6
background-size6
b2c-global-footer-first6
banner6
abonnement6
b2c-global-footer-container6
b2c-global-footer-inner-wrapper6
15px6
80px5
text-decoration5
25
25px5
h25
vertical-align5
35
0px5
45
window5
5px5
-10px5
device-item5
recharger5
margin-right5
font-weight5
pro5
normal5
btn5
tv5
savoir5
54
s204
thank4
b2c-global-footer-social4
tous4
you4
cartes4
swiper-slide4
abonnements4
nbspgonbspplus4
aussi4
f1354
ulflex-direction-nav4
spacebetween4
carte4
se-logo4
rseau4
slidesperview4
jquerythistextreplace4
50px4
float4
appareils4
topoffset4
absolute4
swiper4
tp4
prix4
samsung4
vos4
node-layer-columnsbanner-slider-block-hp4
contactpoint4
promo4
service4
bubble-wrapper4
au4
options4
field-items4
spanbefore4
pricenodecimals4
decimals4
type4
padding-top4
28px4
returns4
commander4
offerpricesoho4
voir4
padding-left4
double4
index4
only4
fix4
commaindex4
fixed4
meilleur3
du3
services3
choisir3
intervient3
galaxy3
device-img3
pas3
image-top-center3
swiper-container3
ou3
une3
centeredslides3
consommation3
swiper-pagination3
swiper-slide-active3
transform2s3
63
solid3
73
support3
device-itemhover3
border-radius3
jquerydocumentreadyfunction3
083nbsp3
90px3
client3
100px3
padding-right3
991px3
order3
0003
prepaid3
postpaid3
belgique3
released3
telephone3
83
contacttype3
customer3
contactoption3
tollfree3
availablelanguage3
field-content3
sticky3
min-width3
1nbsp3
linear-gradientto3
26px3
767px3
18px3
communauteacute3
overflow3
device3
abefore3
padding3
urlhttpsb2cproductionsite-be80wkthrgjjkmzuip0netdna-sslcomsitesb2cfilesbest-deals-micropng3
130px3
hp-banner3
craque3
je3
scroll3
stickyfixed3
b2c-global-footer-list-title3
success3
predicate3
document3
iphone3

Euphony.be Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Euphony.be is a scam?

Websites with Similar Names

Euphodesign.com
ユーフォデザイン(eupho design)・絵本作家・イラスト制作・動画制作・デザイナー
Euphodesign.link
???????? – ??????(Web Site)???????????????????????????(Logo)????????/?????????????(eupho design)
Euphoncommunication.it
Apache2 Ubuntu Default Page: It works
Euphoner.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Arcadiaroundbarn.com 3 seconds ago.Si-vantismortgageprotection.com 4 seconds ago.Trustinaplus.com 5 seconds ago.Shauntatherealtor.com 5 seconds ago.Awesomeporno.com 5 seconds ago.Stjohnsriverhoney.com 5 seconds ago.Rochesterplasticsurgery.com 5 seconds ago.Ninjacat.com 5 seconds ago.Ithinkblackblog.com 6 seconds ago.Joeadase.com 6 seconds ago.Buszymag.com 7 seconds ago.Hackgames.us 7 seconds ago.Cpatrue.com 7 seconds ago.Pornoweekend.com 8 seconds ago.Lebleuaqua.com 8 seconds ago.Psychotherapie-bogenhausen.com 8 seconds ago.Siamcountryclub.com 8 seconds ago.Ges-ar.com 8 seconds ago.Autovidrios.com 8 seconds ago.Caputmundimacro.com 9 seconds ago.Onlymaria.com 9 seconds ago.Trinitymoberly.org 9 seconds ago.Nomadichands.com 10 seconds ago.Primovenues.com 11 seconds ago.Soundslikeviolence.com 11 seconds ago.Blakesuarez.com 11 seconds ago.Andrewnewson.co.uk 11 seconds ago.Flashpeak.com 11 seconds ago.Tipasesores.com 12 seconds ago.Multererlaw.com 12 seconds ago.