Ausbildung und Studium an der Euro Akademie

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 164,446
Estimated Worth: $9
Last updated:2020-10-17

Eine Ausbildung absolvieren und auf Wunsch noch um ein Aufbaustudium ergänzen: Wir begleiten Sie auf dem Weg zu Ihrem Traumberuf.


Domain summary

Domain label
euroakademie
Domain extension
de
Global Traffic Rank
164,446
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is euroakademie.de ranked relative to other sites:

Percentage of visits to euroakademie.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Euroakademie.de registered?
A: Euroakademie.de was registered 4 months, 1 week, 2 days, 9 hours, 19 minutes, 24 seconds ago on Saturday, October 17, 2020.
Q: When was the WHOIS for Euroakademie.de last updated?
A: The WHOIS entry was last updated 2 years, 8 months, 2 weeks, 2 days, 9 hours, 19 minutes, 24 seconds ago on Sunday, June 10, 2018.
Q: What are Euroakademie.de's nameservers?
A: DNS for Euroakademie.de is provided by the following nameservers:
  • f2.de.ha-dns.net
  • ka2.de.ha-dns.net
  • lxa.us.ha-dns.net
  • m.de.ha-dns.net
Q: Who is the registrar for the Euroakademie.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Euroakademie.de?
A: Euroakademie.de ranks 164,446 globally on Alexa. Euroakademie.de has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Euroakademie.de each day?
A: Euroakademie.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Euroakademie.de resolve to?
A: Euroakademie.de resolves to the IPv4 address 212.224.115.66.
Q: In what country are Euroakademie.de servers located in?
A: Euroakademie.de has servers located in the Germany.
Q: What webserver software does Euroakademie.de use?
A: Euroakademie.de is powered by Apache webserver.
Q: Who hosts Euroakademie.de?
A: Euroakademie.de is hosted by First Colo GmbH in Germany.
Q: How much is Euroakademie.de worth?
A: Euroakademie.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Euroakademie.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Euroakademie.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Euroakademie.de

H1 Headings

1 :
  1. Ausbildung, Studium und Weiterbildung an der Euro Akademie

H2 Headings

1 :
  1. Fachwissen, Praxiserfahrung, Sozialkompetenz: Bei uns lernen Sie, was für Ihre spätere Berufstätigkeit wichtig ist. „Persönlichkeit durch Bildung“ ist unser Leitmotiv.

H3 Headings

7 :
  1. Weiterkommen mit Weiterbildung
  2. Schuljahr startet mit Schüler*innen-Rekord an der Berufsschule
  3. Maskenpflicht und Grundrechte in Zeiten der Pandemie
  4. Mein Anerkennungsjahr in Paris
  5. Euro Akademie
  6. Unsere Ausbildungen
  7. Unsere Aufbaustudiengänge

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

5 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

655:

Links - Internal (nofollow)

0:

Links - Outbound

1:

Links - Outbound (nofollow)

0:

Keyword Cloud for Euroakademie.de

zurckeurodaszurckoffice management europasekretrinmarketingihremim fachbereichbei unsesalt zurckofficefachangestelltermedizinischtechnischer assistentin frschulentermineaktuellesber unsltmarketingberufsorientierungsport tourismussozialesheilerziehungspflegerinkinderpflegerinpdagogische fachkraft frfr dialogmarketingkaufmannfrau imausbildungfachbereich fremdsprachengesundheit und sozialesheilerziehungspflegerinkinderpflegerinpdagogischezurckinternationalmanager esaltfrbusiness administration marketingberufsorientierungbei psychischensozialesheilerziehungspflegerinkinderpflegerinpdagogischetopup management businessgemeinsam zukunftmed bademeisterinmedizinischeristfachkraftpsychischeneuro akademiedenmarketingberufsorientierung fresalt zurckoffice managementweitere informationenfr schulentermineaktuellesberschreibeninformationenihnenmagazinsozialesheilerziehungspflegerinkinderpflegerinpdagogische fachkraftgutebusiness managerfachhochschulreifeadministration marketingmanagementadministration marketingmanagement mitschlerinnenwiemanagement europasekretrinmarketingwirtschaftimzurckansprechpartnerinnenschulrumebusiness administration marketingmanagementweiterbildungtermineaktuellesbergemeinsambusiness administrationsindecommercekaufmannfrau imweiterbildungtermineaktuellesber unsltim fachbereich fremdsprachender euroadministrationals topup managementfachangestelltermedizinischtechnischer assistentinunserefachbereich fremdsprachen ampzurckbachelor alsderpdagogiktopup managementunsfremdsprachennachzurckofficetopupweiterbildungentermineaktuellesber unslt zurckansprechpartnerinnenschulrumemarketingmanagement mit spezialisierungensportzurckbachelorzurckbachelor als topupassistentin frfachbereich wirtschaft ampweiterbildungmanagement businesshealthzurckeuro akademieunsltfosakademiesport tourismus oderspezialisierungen in sportbademeisterinmedizinischerfachbereich wirtschaftmarketingmanagement mitmanagerfachhochschulreifedieeuro akademie magazinesaltbeimarketingfort und weiterbildungentermineaktuellesberals topupzurckfachoberschule wirtschaftwiraufmanager esalt zurckofficemarketingfortakademie magazinfachbereichassistentinsozialesfortmitfachkraft frdialogmarketingkaufmannfraufos gesundheitim ecommercekaufmannfrau immanagement business administrationfos wirtschaftmanagerfachhochschulreife fosmarketingmanagementbusinessverwaltungfachoberschulemedfr dialogmarketingkaufmannfrauzurckoffice managementverwaltungfachoberschule gesundheitgesundheit und sozialesfortfremdsprachen ampschulentermineaktuellesbermanagementmanagerfachhochschulreife fos wirtschaftunslt zurckansprechpartnerinnenschulrumeadministration marketingfortweiterbildungentermineaktuellesber unsltmit spezialisierungenbusiness managerfachhochschulreife fosgesundheitfr schulentermineaktuellesber unslttourismus oderdialogmarketingkaufmannfrau imsiebusiness administration marketingfortder euro akademieim fachbereich wirtschaftzurckerzieherinsozialassistentinfortspezialisierungenzukunftwirtschaft ampadministration manager esaltweitereampmit unssozialesmanagerecommercekaufmannfraualsodereuropasekretrinmarketinglernenfachangestelltermedizinischtechnischereineadministration marketingberufsorientierungtourismussozialesfort und weiterbildungentermineaktuellesbereineneurozurckerzieherinsozialassistentinkrankenpflegehelferinpflegefachmannpflegefachfraufortweiterbildungentermineaktuellesberwirtschaft und verwaltungfachoberschuleassistentinltdialogmarketingkaufmannfrau im ecommercekaufmannfrauadministration managerzurckfachoberschuleadministration marketingberufsorientierung frim ecommercekaufmannfrau

Longtail Keyword Density for Euroakademie.de

KeywordsOccurences
als top-up management12
top-up management business12
management business administration12
zurckbachelor als top-up10
business administration marketingfort-8
der euro akademie5
marketingfort- und weiterbildungentermineaktuellesber5
fr schulentermineaktuellesber uns-lt4
administration manager esa-lt4
fr dialogmarketingkaufmannfrau im4
dialogmarketingkaufmannfrau im e-commercekaufmannfrau4
im e-commercekaufmannfrau im4
euro akademie magazin4
wirtschaft und verwaltungfachoberschule3
zurckoffice management europasekretrinmarketing3
esa-lt zurckoffice management3
manager esa-lt zurckoffice3
business administration marketingberufsorientierung3
gesundheit und sozialesfort-3
weiterbildungentermineaktuellesber uns-lt zurckansprechpartnerinnenschulrume3
sozialesfort- und weiterbildungentermineaktuellesber3
administration marketingberufsorientierung fr3
im fachbereich wirtschaft3
fachangestelltermedizinisch-technischer assistentin fr3
fachbereich wirtschaft amp3
gesundheit und sozialesheilerziehungspflegerinkinderpflegerinpdagogische3
managerfachhochschulreife fos wirtschaft3
business managerfachhochschulreife fos3
fachbereich fremdsprachen amp3
im fachbereich fremdsprachen3
sport tourismus oder3
spezialisierungen in sport3
marketingmanagement mit spezialisierungen3
administration marketingmanagement mit3
business administration marketingmanagement3
sozialesheilerziehungspflegerinkinderpflegerinpdagogische fachkraft fr3
zurckeuro akademie35
weiterbildungentermineaktuellesber uns-lt22
business administration14
als top-up12
top-up management12
management business12
euro akademie11
administration manager10
zurckbachelor als10
administration marketingfort-8
im fachbereich7
weiterbildungtermineaktuellesber uns-lt5
der euro5
fremdsprachen amp5
wirtschaft amp5
manager esa-lt4
uns-lt zurckansprechpartnerinnenschulrume4
akademie magazin4
fr schulentermineaktuellesber4
schulentermineaktuellesber uns-lt4
bei psychischen4
fachkraft fr4
e-commercekaufmannfrau im4
im e-commercekaufmannfrau4
dialogmarketingkaufmannfrau im4
fr dialogmarketingkaufmannfrau4
zurckoffice management3
esa-lt zurckoffice3
marketingberufsorientierung fr3
administration marketingberufsorientierung3
administration marketingmanagement3
management europasekretrinmarketing3
zurckfachoberschule wirtschaft3
marketingmanagement mit3
mit spezialisierungen3
gemeinsam zukunft3
sport tourismus3
assistentin fr3
fachangestelltermedizinisch-technischer assistentin3
business managerfachhochschulreife3
weitere informationen3
mit uns3
bei uns3
tourismus oder3
fachbereich wirtschaft3
med bademeisterinmedizinischer3
sozialesheilerziehungspflegerinkinderpflegerinpdagogische fachkraft3
fos gesundheit3
fachbereich fremdsprachen3
fos wirtschaft3
managerfachhochschulreife fos3
verwaltungfachoberschule gesundheit3
akademie46
uns-lt35
zurckeuro35
fr24
administration24
weiterbildungentermineaktuellesber22
business21
amp20
management18
im17
sie16
euro13
der13
mit12
top-up12
als12
wirtschaft12
die11
gesundheit10
zurckbachelor10
uns10
manager10
marketingfort-8
bei8
fachbereich7
auf7
fos6
unsere6
den6
wir6
oder5
magazin5
das5
fremdsprachen5
ist5
zurckfachoberschule5
weiterbildungtermineaktuellesber5
ausbildung5
assistentin5
e-commercekaufmannfrau4
ihnen4
zurckansprechpartnerinnenschulrume4
weitere4
fachkraft4
gemeinsam4
sind4
schulentermineaktuellesber4
med4
psychischen4
esa-lt4
dialogmarketingkaufmannfrau4
einen4
europasekretrinmarketing3
sozialesfort-3
zurckoffice3
verwaltungfachoberschule3
marketingmanagement3
marketingberufsorientierung3
zurckerzieherinsozialassistentinkrankenpflegehelferinpflegefachmannpflegefachfraufort-3
spezialisierungen3
sport3
tourismus3
zurckinternational3
soziales3
assistentin-lt3
lernen3
sozialesheilerziehungspflegerinkinderpflegerinpdagogische3
bademeisterinmedizinischer3
eine3
ihrem3
weiterbildung3
managerfachhochschulreife3
gute3
schlerinnen3
fachangestelltermedizinisch-technischer3
nach3
pdagogik3
informationen3
zukunft3
schreiben3
wie3
health3
zurckerzieherinsozialassistentinfort-3

Who hosts Euroakademie.de?

Euroakademie.de Hosting Provider Information

Hosted IP Address:212.224.115.66
Hosted Hostname:212.224.115.66
Service Provider:First Colo GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "First Colo GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
First Colo GmbH
0.0257%

HTTP Header Analysis for Euroakademie.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 17 Oct 2020 08:21:32 GMT
Server: Apache
X-Powered-By: PHP/5.4.28
Expires: Sat, 17 Oct 2020 22:00:00 GMT
ETag: "2741b93527e8e4fcd6c2ee9eed3e0a8a"-gzip
Cache-Control: max-age=49108
Pragma: public
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 27719
Content-Type: text/html; charset=utf-8

Euroakademie.de Domain Nameserver Information

HostIP AddressCountry
f2.de.ha-dns.net 89.146.248.15
ka2.de.ha-dns.net 217.160.113.60
lxa.us.ha-dns.net 74.208.254.15
m.de.ha-dns.net 62.116.159.28


Need to find out who hosts Euroakademie.de?


Domain Registration (WhoIs) information for Euroakademie.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: euroakademie.de
Nserver: f2.de.ha-dns.net
Nserver: ka2.de.ha-dns.net
Nserver: lxa.us.ha-dns.net
Nserver: m.de.ha-dns.net
Status: connect
Changed: 2018-06-10T11:19:05+02:00

Websites with Similar Names

Euroa.org.au
Hacked By MR.GREEN – Just another WordPress site
Euroabattoir.com
Butchery Market ;The first online market for butchers and meat industry
Euroabogados.com
euroabogados.com is available for purchase - Sedo.com
Euroacademia.com.ua
НКЦ "Євроакадемія": [[Page.title()]]
Euroacademia.eu
Euroacademia - FOR A EUROPE OF KNOWLEDGE DISSEMINATION, VALORIZATION AND ACADEMIC DEBATE
Euroacademia.ro
Acasa - Cursuri | Evaluari | Calificari | Specializari
Euroacademy.online
euroacademy.online – speak ;ouder

Recently Updated Websites

Griswold4vacations.com (1 second ago.)Windmillquarter.com (3 seconds ago.)Gloryislandgrenada.com (3 seconds ago.)Dvho.store (4 seconds ago.)Marketandvineblog.com (5 seconds ago.)Childrenbronze.com (6 seconds ago.)Termin.bayern (6 seconds ago.)Commercepills.com (8 seconds ago.)Angelsoflove.foundation (8 seconds ago.)Exquisiteendeavors.com (8 seconds ago.)Deunlugar.com (9 seconds ago.)Sharemyfilessafely.com (14 seconds ago.)Jyvalve.co.kr (15 seconds ago.)Pgcityhc.org (15 seconds ago.)Cfwqvbus.com (15 seconds ago.)Thelibrary.academy (17 seconds ago.)Nawarrealestate.com (19 seconds ago.)Metragesaz.co.ir (20 seconds ago.)Listings.domains (20 seconds ago.)Alberguedesoniafinisterre.com (22 seconds ago.)Casusgrillitaly.com (22 seconds ago.)Austinshirtlab.com (23 seconds ago.)Hvacsocialcovers.com (23 seconds ago.)Vminvestmentsltd.org (23 seconds ago.)Beleak.com (26 seconds ago.)Spinksnotary.com (29 seconds ago.)Locdagang.com (29 seconds ago.)Truevaluehardware.net (29 seconds ago.)Gucci-tw.net (31 seconds ago.)E-visabrazil.us (31 seconds ago.)

Recently Searched Keywords

maple gold mines stock (4 seconds ago.)show all desktops (6 seconds ago.)szczcie (11 seconds ago.)real father son (12 seconds ago.)speicherplatz (15 seconds ago.)données constructeur (28 seconds ago.)cantabria.cloud (31 seconds ago.)thưởng thức đặc sản thịt lợn sapa – đậm đà bản sắc dân tộc (32 seconds ago.)cantabria.cloud (36 seconds ago.)iu kinh (39 seconds ago.)paneli (43 seconds ago.)terrorist attack (45 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (47 seconds ago.)0 0 028 (54 seconds ago.)tpl-meet-the-staff main-staff (57 seconds ago.)border-width1px background-colorrgba24 (58 seconds ago.)color rgb37 37 (1 minute 4 seconds ago.)9159nbspnbspnbspnbsp9159 (1 minute 6 seconds ago.)na yczenie (1 minute 9 seconds ago.)intelligente (1 minute 10 seconds ago.)cashew (1 minute 14 seconds ago.)nohay 2021 mp3 download nadeem sarwar (1 minute 19 seconds ago.)tiernahrung (1 minute 22 seconds ago.)lehrermarktplatz (1 minute 23 seconds ago.)been verified yet (1 minute 24 seconds ago.)plural2number return result (1 minute 27 seconds ago.)performance of our (1 minute 28 seconds ago.)гороскоп на май 2020 скорпион (1 minute 29 seconds ago.)tarife (1 minute 30 seconds ago.)programming notes (1 minute 33 seconds ago.)