Evanfarmer.net Favicon Evanfarmer.net

Evanfarmer.net Website Thumbnail
Checking...
EVAN FARMER
Low trust score
Add a review Change category Claim this site
Official Page of Evan Farmer ~ Author, Actor, Musician, Host, Product Designer/Customizer, Entrepreneur, and President of The Building Barn, LLC.


Domain summary

Domain label
evanfarmer
Domain extension
net
Domain registered:
2000-01-06
Domain updated:
2017-08-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is evanfarmer.net ranked relative to other sites:

Percentage of visits to evanfarmer.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Evanfarmer.net registered?
A: Evanfarmer.net was registered 20 years, 8 months, 3 weeks, 20 hours, 2 minutes, 18 seconds ago on Thursday, January 6, 2000.
Q: When was the WHOIS for Evanfarmer.net last updated?
A: The WHOIS entry was last updated 3 years, 1 month, 1 week, 5 days, 20 hours, 2 minutes, 18 seconds ago on Tuesday, August 15, 2017.
Q: What are Evanfarmer.net's nameservers?
A: DNS for Evanfarmer.net is provided by the following nameservers:
  • dns1.p06.nsone.net
  • dns2.p06.nsone.net
  • dns3.p06.nsone.net
  • dns4.p06.nsone.net
Q: Who is the registrar for the Evanfarmer.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Evanfarmer.net?
A: Evanfarmer.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Evanfarmer.net each day?
A: Evanfarmer.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Evanfarmer.net resolve to?
A: Evanfarmer.net resolves to the IPv4 address 198.49.23.144.
Q: In what country are Evanfarmer.net servers located in?
A: Evanfarmer.net has servers located in the United States.
Q: What webserver software does Evanfarmer.net use?
A: Evanfarmer.net is powered by Squarespace webserver.
Q: Who hosts Evanfarmer.net?
A: Evanfarmer.net is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Evanfarmer.net worth?
A: Evanfarmer.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Evanfarmer.net?

Evanfarmer.net Hosting Provider Information

Hosted IP Address:198.49.23.144
Hosted Hostname:198.49.23.144
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Evanfarmer.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
date: Sat, 05 Sep 2020 08:14:55 GMT
location: https://evanfarmer.com/
Age: 502672
Content-Length: 0
x-contextid: tJR1UIMs/jxm2ZwKb
server: Squarespace

Evanfarmer.net Domain Nameserver Information

HostIP AddressCountry
dns1.p06.nsone.net 198.51.44.6
dns2.p06.nsone.net 198.51.45.6
dns3.p06.nsone.net 198.51.44.70
dns4.p06.nsone.net 198.51.45.70


Need to find out who hosts Evanfarmer.net?


WhoIs information for Evanfarmer.net

 Domain Name: EVANFARMER.NET
Registry Domain ID: 16654349_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2017-08-15T18:00:21Z
Creation Date: 2000-01-06T04:15:00Z
Registry Expiry Date: 2022-01-06T04:14:59Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: DNS1.P06.NSONE.NET
Name Server: DNS2.P06.NSONE.NET
Name Server: DNS3.P06.NSONE.NET
Name Server: DNS4.P06.NSONE.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-04-08T22:30:56Z

Evanfarmer.net Free SEO Report

Website Inpage Analysis for Evanfarmer.net

H1 Headings

1 :
  1. Evan Farmer

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

8:
  1. The Building Barn
    http://www.thebuildingbarn.com
  2. Barn Built
    http://www.barnbuilt.com
  3. Buy Book
    https://www.amazon.com/How-Break-Formula-Success-Entertainment/dp/B07CNJS62S/ref=tmm_aud_swatch_0?_encoding=UTF8&qid=&sr=&dpID=51hy-zZFWDL&preST=_SX342_QL70_&dpSrc=detail
  4. IMDB
    http://www.imdb.com/name/nm0267745/
  5. Wikipedia
    http://en.wikipedia.org/wiki/Evan_Farmer
  6. No text
    https://www.linkedin.com/in/evan-farmer-87ba6ba
  7. No text
    http://instagram.com/thebuildingbarn
  8. No text
    https://twitter.com/EvanFarmer

Links - Outbound (nofollow)

0:

Keyword Cloud for Evanfarmer.net

sqsmodallightboxcontent lightboxinnertwitterfivehundredpixdataslicetypesocialiconshover stumbleuponiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutdataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagedataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagesqsalbumminimalsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialicons rdiodataslicetypesocialiconshover googleplayhover2siconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesoliddataslicetypepasswordvideoiconstyleknockoutvscobuttonstyleoutlinedataslicetypesocialicons dropboxsocialiconssizemediumsocialiconsstyleknockoutlockstylesolidinputtypesubmithoversqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstyleknockoutresponsivewrappersocialiconsstylesolid dataslicetypesocialicons2s easesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover applepodcastflickrhoverstitcherhorizontalpositioningrightalignmentleft sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage01sdataslicetypesocialiconshover stitchersocialiconssizesmallsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaysqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayaction170ms easeinoutotransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlineulstackeddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutalignmentcentercountdowncontentdataformatnumericdataslicetypesocialiconshover linkedinsocialiconsstyleregular dataslicetypesocialiconsimdbdataslicetypesocialiconshover dribbblehoverdisclaimercontainersqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperhorizontalpositioningrightalignmentcenter layerfrontvevodataslicetypesocialicons imdbsocialiconssizeextralargesocialiconsstyleregularsqsslidelayercontentdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonssqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactionyoutubehoversqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderdataslicetypealbum sqsslicealbumplaylist tracksdataslicetypesocialiconshover youtubebuttonstyleoutlinesqsmodallightbox formwrapper10pxsocialstackedtextalignleft dataslicetypesocialiconshorizontalpositioningleftalignmentcenter layerfronticonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidsqsslidelayercontentmargin0dataslicetypesocialiconshover tumblreaseinoutsocialiconsstylesolid dataslicetypesocialiconshovertrackspansqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover behanceiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolideaseinoutotransitioncolordataslicetypebuttonssqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpage170ms easeinouttransitionbackgroundcolorhorizontalpositioningleftalignmentleft sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutspotifydataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesoliddataslicetypesocialicons applepodcastcodepenpinterestsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperbehanceresponsivewrapperstacked sqsslicecustomformsqsslidewrapperdataslidetypecoverpage responsivewrappernotstackedbordercolordataslicetypesocialiconshover emailsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpageeaseintransitionopacity 2suldataslicetypesocialiconshover imdbdataslicetypesocialicons tumblrdataslicetypetwitternotdatacompoundtype tweetbodyvinelidataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolid170ms easeinoutmstransitionbackgroundcolorlightboxinner2s easeinmoztransitionopacityiconwrapperborder2pxuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborderdataslicetypegallery galleryvideobackgroundmobilesqsslicealbumplaylistactionsstacked inputwrappernothiddenrssalignmentcenter responsivewrapperstackedsqsalbumminimal dataslicetypealbum sqsslicealbumplaylisticonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover soundclouddataslicetypesocialicons squarespacevevohovericonwrapperwidth32pxheight32pxmargin0lockstyleborder dataslicetypelockgalleryvideobackgroundmobileahoversqsslidewrapperdataslidetypecoverpagesquarespacedataslicetypesocialiconshover smugmugdataslicetypecountdown countdowncontentdataformattextual countdownunituseiconfille4405fsqsslidewrapperdataslidetypecoverpageuseiconfill000sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover foursquareuseiconfille6b91esqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover itunesdataslicetypesocialicons itunesuseiconfillff0031sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons flickrsocialstacked dataslicetypesocialiconsuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconssvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfill00b4b3sqsslidewrapperdataslidetypecoverpageinputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vevotweettimestampiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutsqsslicealbumplayliststackedaudioplayericonsstyleregularsqsslidewrapperdataslidetypecoverpage dataslicetypecountdowndataslicetypesocialiconshover twitchhovereaseinotransitionopacity 2s2s easeinmoztransitionopacity 2ssqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumaudioplayericonsstyleborder dataslicetypealbumbuttonshaperoundedcornersvideoiconstyleborderuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverbordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagehorizontalpositioningrightalignmentcentericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutpaudioplayericonsstyleknockoutvscohoverbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypesocialiconshover imdbhoverpasswordstyleunderlined170ms easeinoutmoztransitionbackgroundcoloruseiconfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover soundcloudhoverdataslicetypesocialiconshover vsco2emuseiconfillec4652sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover foursquarehoversocialiconssizeextrasmallsocialiconsstyleregularusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshovericonwrapperhovereaseinoutmoztransitionbackgroundcolorsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonssqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialiconshover spotifyhovereaseinoutmoztransitionbackgroundcolor 170msuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover rssiconwrapperlastchildsqsslidewrapperdataslidetypecoverpagedataslicetypetwittersvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover codepenhoverneuearialsansseriffontweight400fontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeoiconwrapperuseiconfill0063dcsqsslidewrapperdataslidetypecoverpageaudioplayericonsstylesolid1sdataslicetypesocialicons dribbbleul li asqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconsp asqsslidewrapperdataslidetypecoverpagelightboxcontent formwrapper pdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidsolidsnapchatbuttonstyleoutlinesqsmodallightboxsmugmughoverredditlisqsslidewrapperdataslidetypecoverpage0 0sqsslidewrapperdataslidetypecoverpagesqsmodallightboxopenuseiconfill8c8070sqsslidewrapperdataslidetypecoverpagegoogleplayhovereaseinoutotransitionbackgroundcolordataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverusebackgroundfillfffsqsslidewrapperdataslidetypecoverpagedataslicetypemap gmstylecceaseinoutmstransitionbackgroundcolor 170msdataslicetypesocialiconshover flickrhoverhorizontalpositioningleftalignmentleft layerfrontdataslicetypesocialiconshover dribbbleusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutsqsslicealbumplaylist tracks trackbuttontypesubmitsqsslidewrapperdataslidetypecoverpagegalleryvideobackgroundapplepodcasthoverdataslicetypenavigation ulyoutubemeetuphoverdataslicetypesocialiconshover googlehoversqsslidelayercontentmargin0 0iconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpageemailsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautodataslicetypebuttons ulstackedhorizontalpositioningleftalignmentright layerfrontsocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialiconshover twitcheaseinotransitionopacityuseiconfill3b5998sqsslidewrapperdataslidetypecoverpageuseiconfill0976b4sqsslidewrapperdataslidetypecoverpagealignmentrightrsshoverresponsivewrapperstacked dataslicetypenavigationdataslicetypesocialiconshover meetuplockstyleknockoutdataslicetypesocialiconshover vscohoverlayerfrontsqsslicealbumplaylistplayingsmugmugcodepenhovereaseinmoztransitionopacity 2stwitch170ms easeinoutsqsslidewrapperdataslidetypecoverpagesqsslicecustomformsqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsfacebookhoveruseiconfill84bd00sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons vevodataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypelockdataslicetypesocialiconshover redditarrowiconsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackeddataslicetypesocialiconshover fivehundredpixhoverdataslicetypealbumbuttonstyleoutline datacompoundtypepopupoverlayactionrdiohoveruseiconfillfffsqsslidewrapperdataslidetypecoverpagesocialstackedasqsslidewrapperdataslidetypecoverpage buttonstyleoutlinethedotshorizontalpositioningleftalignmentright sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagedribbblehoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover stumbleuponhoversquarespacehoveruseiconfillea4c89sqsslidewrapperdataslidetypecoverpagedropboxhoverdataslicetypealbum iconwrapperdataslicetypecountdown countdowncontentdataformattextuallayerfront sqsslidelayercontentmargin0gmstylecciconwrapperwidth36pxheight36pxmargin0showtracktitledataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpageinstagramfivehundredpixhoversqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagelockstyleregular dataslicetypelockdataslicetypesocialiconshover snapchathoverusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons tidalbuttonstyleoutline sqsslicecustomformdataslicetypebuttons ulsqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpagepasswordstylerectangledataslicetypesocialiconshover codependropboxdataslicetypesocialiconshovercaptchacontainerwrapperdataslicetypesocialicons spotifyinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagesocialstackedtextalignleftactionsnotstacked inputwrappernothiddendataslicetypesocialiconshover tumblrhoverinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddenuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpagesocialiconsstyleknockout dataslicetypesocialiconsinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinesqsslidecontainernotautoimagebackgroundcolordatacompoundtypepopupoverlayactionsocialiconssizelargesocialiconsstyleregularthedotshoverdataslicetypesocialiconshover githubhoverdatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconshover iconwrappermedium170ms easeoutopacitysocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline5emfont14pxsocialiconscolorstandardsocialiconsstyleborderdataslicetypesocialicons vineeaseinoutsqsslidewrapperdataslidetypecoverpagebuttonstyleoutline dataslicetypebuttonsdataslicetypesocialicons codepenuseiconfill6441a5sqsslidewrapperdataslidetypecoverpagebehancehoveractionsstacked inputwrapperdataslicetypesocialiconshover snapchatsocialiconssizelargesocialiconsstyleborderresponsivewrapperstacked dataslicetypenavigation ulemailhover0px 0pxdataslicetypesocialiconshover youtubehovervimeohoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsbandsintownhoverdataslicetypesocialicons smugmugautoflex1useiconfillae995asqsslidewrapperdataslidetypecoverpagedataslicetypebuttons asqsslidewrapperdataslidetypecoverpagetweetbodysocialiconsstyleborderformwrapper psqsslicecustomform spansqsslidewrapperdataslidetypecoverpageinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactioneaseinouttransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenableddataslicetypebuttons liformitemsqsslidewrapperdataslidetypecoverpagesqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningrightalignmentrightsvgsocialwebkittransitionbackgroundcolordataslicetypesocialiconshover pinterestdataslicetypesocialiconshover fivehundredpixsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked0dataslicetypealbumhover iconwrapperhoversocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshovereaseinoutmstransitionbackgroundcolordataslicetypesocialiconshover goodreadssqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodybuttonplaypauseshowtracktitle sqsalbumminimal dataslicetypealbumdataslicetypesocialiconshover squarespacehoverdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeohoverallgooglehoverdataslicetypealbum sqsslicealbumplaylistplayingsqssliceplaybuttoniconwrapperdataslicetypesocialiconshover iconwrapperhoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlinedgoodreadsdataslicetypesocialicons linkedinformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinesocialiconsstyleknockoutdataslicetypebuttonsasqsslidewrapperdataslidetypecoverpage dataslicetypetwitterusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover rdiohover4pxusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsvimeoeaseinoutotransitionbackgroundcolor 170msdataslicetypesocialiconshover twitterall and maxwidth600pxsqsslidewrapperdataslidetypecoverpageasqsslidewrapperdataslidetypecoverpagemaxwidth600pxsqsslidewrapperdataslidetypecoverpagesqsslidelayercontentsqsslidewrapperdataslidetypecoverpagetidalhoverdataslicetypesocialicons soundclouddataslicetypetwitter tweetavatarflickrsocialiconscolorstandardsocialiconsstylesolidaudioplayericonsstylesolid dataslicetypealbumhover1dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutdataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpageuseiconfillf60sqsslidewrapperdataslidetypecoverpageuseiconfillf94877sqsslidewrapperdataslidetypecoverpagedataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover thedotshovermediumhoverdataslicetypesocialiconshover yelpapplepodcastsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonssqsslicealbumplaylist tracks170ms easeinoutotransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactioneaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolordataslicetypesocialicons twitch3pxsqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningrightalignmentcenteractionsnotstackedulsqsslidewrapperdataslidetypecoverpageshowtracktitle sqsalbumminimal0pxuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoversqsslidesqsslideanimationreadyresponsivewrapperstacked dataslicetypebuttons uldataslicetypesocialiconshover emailhoverdataslicetypesocialiconshover googletweetdisplayname2em 0pxdataslicetypemaplightboxinner lightboxcontent formwrapperuseiconfill5adfcbsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinedataslicetypenavigationli ahoversqsslidewrapperdataslidetypecoverpagedataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons goodreadssocialiconssizeextralargesocialiconsstylesolidformwrappersqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpage0 0screen and maxwidth600pxsqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked dataslicetypebuttonssqsslidewrapperdataslidetypecoverpage dataslicetypebuttonsusemaskfilltransparentsqsslidewrapperdataslidetypecoverpageeaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagesocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagereddithoverdataslicetypesocialiconshover dropboxdataslicetypesocialiconshover flickrul lisqsslidewrapperdataslidetypecoverpageuseiconfill4183c4sqsslidewrapperdataslidetypecoverpagesocialiconssizesmallsocialiconsstyleregularstitcherhoverdataslicetypesocialiconshover goodreadshoversqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideiniconwrapperwidth28pxheight28pxmargin0tumblrhoversocialiconsstylesoliddataslicetypetwitternotdatacompoundtypevideoiconstylesolidyelpusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpageli asqsslidewrapperdataslidetypecoverpageuseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpagesqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypealbumhover iconwrappersqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody puseiconfille0393esqsslidewrapperdataslidetypecoverpageuseiconfill7dbb00sqsslidewrapperdataslidetypecoverpageonly screenresponsivewrappernotstackeduseiconfill222sqsslidewrapperdataslidetypecoverpage2s easeinotransitionopacityeaseinouttransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddendataslicetypesocialicons twitteruseiconfillff4500sqsslidewrapperdataslidetypecoverpage0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover linkedinhoversocialiconssizesmallsocialiconsstylesolidsocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsscreenuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulareaseinmstransitionopacity 2suseiconfill0099e5sqsslidewrapperdataslidetypecoverpagelinkedinhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutlightboxcontent formwrapperuseiconfill007ee5sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons houzzdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsocialiconscolorstandardsocialiconsstyleregulartrackprogressbarlinkedinusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypegallerysqsgallerygrid8pxactionssqsslidewrapperdataslidetypecoverpagepasswordstylerectangle dataslicetypepasswordfffsqsslidewrapperdataslidetypecoverpagehorizontalpositioningrightalignmentleftsqsslicecustomform asqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons pinterestsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedsqsslicegroupbottomfullwidthsqsslidewrapperdataslidetypecoverpage170ms easeinoutmstransitionbackgroundcolor 170mseaseinout bordercolor 170mssocialiconssizeextralargesocialiconsstyleknockoutspotifyhover2s easeinotransitionopacity 2situnescountdowncontentdataformattextual countdownunitdataslicetypesocialicons yelpsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveravisitedsqsslidewrapperdataslidetypecoverpage2s easeinmstransitionopacity 2sdataslicetypesocialicons foursquarefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emaudioplayericonsstyleregular dataslicetypealbum2em 0px 0pxuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconslockstylesolid dataslicetypelockdataslicetypesocialiconshover meetuphoverhorizontalpositioningrightalignmentcenter sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover applepodcasthoverbuttonstylesoliddataslicetypesocialiconshover googleplayhorizontalpositioningrightresponsivewrapperstacked dataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vevohoversocialiconssizelargesocialiconsstyleknockoutdataslicetypesocialicons stitchersqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningleftalignmentleftsoundcloudfacebooksqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactionbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinelockstyleknockout dataslicetypelocktracks trackdataslicetypealbum sqsslicealbumplaylistdemoalbumdataslicetypesocialicons googleplaybordercolor 170mscountdowncontentdataformattextualdataslicetypemap gmnoprintsnapchathoverdataslicetypealbum tracktitleuseiconfill7ac143sqsslidewrapperdataslidetypecoverpagesqsslidelayercontentmargin0 0 0useiconfill55aceesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stitcherhoverfoursquaredataslicetypealbum trackprogressbarsqsalbumminimal dataslicetypealbumhorizontalpositioningleftalignmentcenter sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagegoodreadshovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonseaseoutopacitymapstyleminimaldark2s easeinmstransitionopacityformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinelightboxinner lightboxcontentdataslicetypesocialiconshover houzzfoursquarehoverdataslicetypesocialicons instagramdataslicetypesocialiconshover behancehoveruseiconfillcc2127sqsslidewrapperdataslidetypecoverpagedataslicetypebodyadisplayblocksqsslidewrapperdataslidetypecoverpageuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfill1ab7easqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformatnumerictwitchhoverdataslicetypegallerylockstyleborderdataslicetypesocialiconshover dropboxhoverbuttonstyleraisedautosqsslidewrapperdataslidetypecoverpagealignmentright responsivewrapperstackediconwrapperwidth24pxheight24pxmargin0170msdataslicetypesocialiconshover bandsintownformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons lisocialiconsstyleregulardataslicetypesocialicons stumbleuponeaseinoutmoztransitioncolordataslicetypesocialicons rsseaseinmoztransitionopacitydataslicetypesocialicons mediumstumbleuponsqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackeddataslicetypesocialiconshover instagramhoverdataslicetypesocialiconshover rsshovereaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolortumblrlayerfront sqsslidelayercontentmargin0 0buttonsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover mediumcountdownunitinputtypetextsqsslidewrapperdataslidetypecoverpage170ms easeinouttransitionbackgroundcolor 170msdataslicetypesocialiconshover squarespaceuseiconfill00ab6csqsslidewrapperdataslidetypecoverpageuseiconfill006ed2sqsslidewrapperdataslidetypecoverpagesqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningleftalignmentcenterul lidataslicetypesocialiconshover vinesocialiconssizeextrasmallsocialiconsstyleborder0ms 0msdataslicetypesocialicons emailuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons vimeopasswordstyleunderlined dataslicetypepassworddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpageinputwrappernothiddendataslicetypesocialicons bandsintownsocialiconssizemediumsocialiconsstyleregulargithubhoversocialiconssizemediumsocialiconsstylebordersqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleft5pxusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialicons snapchatdataslicetypecountdownresponsivewrapperstackedtextaligncenterdataslicetypesocialiconshover thedotsvinehoversqsslicecustomform14pxtweethandle170ms easeoutopacity 170ms0 autosqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons githubsqssliceplaybuttoniconwrapperhovereaseinout bordercolordataslicetypesocialiconshover tidalhoverhorizontalpositioningleftdataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpageuseiconfill00b488sqsslidewrapperdataslidetypecoverpage2s easeintransitionopacity 2sdataslicetypesocialicons youtubeiconwrappersqsslidewrapperdataslidetypecoverpagehorizontalpositioningleftalignmentcenter7pxsqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover spotifysocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialiconshover yelphoversocialiconssizelargesocialiconsstylesolidsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverpinteresthovermeetupsocialiconssizemediumsocialiconsstylesoliddataslicetypealbum sqsslicealbumplaylistuseiconfilldc4e41sqsslidewrapperdataslidetypecoverpageeaseinmstransitionopacitydataslicetypenavigation ul libuttonshapepill100msp ahoversqsslidewrapperdataslidetypecoverpage170ms easeinout bordercolor2s 2sdataslicetypesocialiconshover mediumhoverresponsivewrapperstackedgithub60pxsvgsocialwebkittransitionbackgroundcolor 170msdataslicetypetwitternotdatacompoundtype tweettimestampyelphoverhouzzdataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsmodallightboxdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseduseiconfilleb4924sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectanglelayerfront sqsslidelayercontentsqsslidewrapperdataslidetypecoverpagegmnoprinticonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesoliddataslicetypegallery galleryvideobackgrounddataslicetypesocialiconshover githubinputwrappersqsslidecontainerdataslidetypepopupoverlay captchacontainerwrappereaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolorsocialiconssizeextralargesocialiconsstylebordertwitterhoverasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformsocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshorizontalpositioningrightalignmentright layerfrontdribbbledataslicetypesocialiconshover ituneshoverdataslicetypealbum sqsslicealbumplayliststackedinputtypepasswordsqsslidewrapperdataslidetypecoverpageinstagramhovertracktitledataslicetypepassword arrowiconeaseintransitionopacityhorizontalpositioningrightalignmentrightsqsmodallightboxcontentdataslicetypesocialicons redditsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautodataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons thedotsdisplaytablesqsslidewrapperdataslidetypecoverpageuseiconfill382110sqsslidewrapperdataslidetypecoverpagedataslicetypebody paudioplayericonsstyleborderdataslicetypesocialicons behanceeasesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover reddithoverhorizontalpositioningleftalignmentleft6pximdbhoversqsmodallightboxcontent lightboxinner lightboxcontentlightboxcontent2s easeintransitionopacityuseiconfill35465dsqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypebuttons li asqsslidewrapperdataslidetypecoverpagesqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningrightalignmentlefteaseinoutmstransitioncolorsvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolorformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagetidalhorizontalpositioningrightalignmentright sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons googlevideoiconstyleregulartrackssqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningleftalignmentrightdataslicetypebuttons lisqsslidewrapperdataslidetypecoverpage170ms easeinoutmoztransitionbackgroundcolor 170msactionsstackedgoogledataslicetypesocialiconshover smugmughoveronlyeaseoutopacity 170msdataslicetypealbumhoversqsslicealbumplaylistdemoalbumimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcolordataslicetypesocialiconshover facebookhoverituneshoversocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagebandsintownsocialiconssizesmallsocialiconsstyleborderhorizontalpositioningleftalignmentrightdataslicetypesocialiconshover pinteresthoverdataslicetypesocialiconshover vinehoveruseiconfillc41200sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons fivehundredpixrdioiconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterdataslicetypesocialiconshover iconwrapperfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxerrormessagesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover twitterhoverdataslicetypesocialiconshover bandsintownhover0mssocialiconsstyleborder dataslicetypesocialiconsiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialiconshover rdiouseiconfille52d27sqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialicons vscodataslicetypesocialiconshover facebookdataslicetypeheadingnotdatacompoundtypedataslicetypesocialicons facebookdataslicetypesocialiconshover instagramlockstyleregulareaseinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesolidsocialiconscolorstandardsocialiconsstyleknockouthouzzhoverusemaskfill222sqsslidewrapperdataslidetypecoverpageuseiconfill1769ffsqsslidewrapperdataslidetypecoverpage170ms easeinoutsocialiconssizeextrasmallsocialiconsstylesolidgoogleplaydataslicetypesocialicons meetupstumbleuponhoverinputtypesubmitsqsslidewrapperdataslidetypecoverpagetweetavatardataslicetypesocialiconshover tidaldataslicetypesocialiconshover houzzhovermaxwidth1020pxsqsslidewrapperdataslidetypecoverpagesoundcloudhover1pxdataslicetypebuttons ul lieaseinouttransitioncolorall and maxwidth1020pxsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayaction

Longtail Keyword Density for Evanfarmer.net

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
lightbox-inner lightbox-content form-wrapper14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
2em 0px 0px6
show-track-title sqs-album-minimal data-slice-typealbum6
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
responsive-wrapperstacked data-slice-typenavigation ul6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
data-slice-typenavigation ul li5
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
responsive-wrapperstacked data-slice-typebuttons ul5
170ms ease-outopacity 170ms5
sqs-slide-layer-contentmargin0 0 04
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
lightbox-content form-wrapper p4
layer-front sqs-slide-layer-contentmargin0 04
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
data-slice-typebuttons ul li4
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
all and max-width1020pxsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
responsive-wrapperstacked data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid88
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstacked data-slice-typesocial-icons20
socialstackedtext-align-left data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
170ms ease-in-out15
border-color 170ms15
data-slice-typealbum sqs-slice-album-playlist15
ease-in-out border-color15
lightbox-content form-wrapper14
data-slice-typebuttons ul14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
data-slice-typenavigation ul12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
0 0sqs-slide-wrapperdata-slide-typecover-page12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
data-slice-typecountdown countdown-contentdata-formattextual11
data-slice-typealbum icon-wrapper11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
sqs-slice-album-playlist tracks11
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
layer-front sqs-slide-layer-contentsqs-slide-wrapperdata-slide-typecover-page10
data-slice-typebuttons li10
password-style-underlined data-slice-typepassword10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
ul li9
li asqs-slide-wrapperdata-slide-typecover-page9
responsive-wrapperstacked data-slice-typenavigation9
password-style-rectangle data-slice-typepassword9
responsive-wrapperstacked data-slice-typebuttons9
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page8
layer-front sqs-slide-layer-contentmargin08
ease-in-outtransitionbackground-color 170ms8
social-icons-style-solid data-slice-typesocial-iconshover8
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
social-icons-style-border data-slice-typesocial-icons7
button-style-outlinesqs-modal-lightbox form-wrapper7
ul lisqs-slide-wrapperdata-slide-typecover-page7
show-track-title sqs-album-minimal7
tracks track7
button-style-outline data-compound-typepopup-overlay-action7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
0px 0px6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
2em 0px6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
data-slice-typesocial-iconshover icon-wrapperhover6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
button-style-outline data-slice-typebuttons6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
data-slice-typealbum track-progress-bar6
audio-player-icons-style-border data-slice-typealbum6
button-style-outline sqs-slice-custom-form6
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons vsco5
data-slice-typesocial-icons email5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons dribbble5
alignment-center responsive-wrapperstacked5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons dropbox5
data-slice-typesocial-icons fivehundredpix5
alignment-right responsive-wrapperstacked5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons google5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons github5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons vevo5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons tumblr5
data-slice-typealbum sqs-slice-album-playlistplaying5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-iconshover icon-wrapper5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
ease-outopacity 170ms5
170ms ease-outopacity5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons snapchat5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typesocial-icons squarespace5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
data-slice-typesocial-icons bandsintown5
data-slice-typesocial-icons youtube5
data-slice-typesocial-icons codepen5
0ms 0ms5
2s 2s5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons behance5
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typesocial-iconshover tumblr4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
data-slice-typesocial-iconshover yelphover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover youtubehover4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
horizontal-positioning-leftalignment-right layer-front4
actionsnotstacked input-wrappernothidden4
form-wrapper p4
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border data-slice-typelock4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typealbumhover icon-wrapper4
horizontal-positioning-leftalignment-left layer-front4
sqs-slide-layer-contentmargin0 04
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover vimeohover4
0 04
data-slice-typetwitternotdata-compound-type tweet-body4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover yelp4
horizontal-positioning-rightalignment-right layer-front4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover facebook4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover behance4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover smugmughover4
svgsocial-webkit-transitionbackground-color 170ms4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover google4
actionsstacked input-wrappernothidden3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity3
ease-intransitionopacity 2s3
data-slice-typegallery gallery-video-backgroundmobile3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
audio-player-icons-style-regular data-slice-typealbum3
data-slice-typealbum track-title3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum sqs-slice-album-playliststacked3
only screen3
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
data-slice-typemap gm-style-cc3
actionsstacked input-wrapper3
ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-rightalignment-left3
horizontal-positioning-leftalignment-left sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
horizontal-positioning-rightalignment-center layer-front3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
0 autosqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-rightalignment-right3
horizontal-positioning-rightalignment-right sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-rightalignment-center3
horizontal-positioning-rightalignment-center sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
horizontal-positioning-rightalignment-left sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-leftalignment-left3
2s ease-in-moz-transitionopacity3
ease-in-moz-transitionopacity 2s3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-leftalignment-right3
horizontal-positioning-leftalignment-right sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-ms-transitionopacity3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-leftalignment-center3
horizontal-positioning-leftalignment-center sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
horizontal-positioning-leftalignment-center layer-front3
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
data-slice-typemap gmnoprint3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
countdown-contentdata-formattextual countdown-unit3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
p asqs-slide-wrapperdata-slide-typecover-page3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
lock-style-knockout data-slice-typelock3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
data-slice-typebuttons ulstacked3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitter tweet-avatar3
lock-style-solid data-slice-typelock3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
social-icons-style-knockout data-slice-typesocial-icons3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
2s easesqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
data-slice-typepassword arrow-icon3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
social-icons-style-solid data-slice-typesocial-icons3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page140
social-icons-color-standardsocial-icons-style-knockout132
social-icons-color-standardsocial-icons-style-regular132
data-slice-typealbum109
170ms90
data-slice-typebuttons63
data-compound-typepopup-overlay-action60
sqs-slide-containerdata-slide-typepopup-overlay51
icon-wrappersqs-slide-wrapperdata-slide-typecover-page46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page44
2s41
asqs-slide-wrapperdata-slide-typecover-page39
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typecover-page34
data-slice-typegallery33
layer-front31
responsive-wrapperstacked31
data-slice-typelock30
030
data-slice-typepassword29
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
form-wrapper28
sqs-album-minimal27
ul26
0sqs-slide-wrapperdata-slide-typecover-page25
1s25
sqs-modal-lightbox-content24
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
sqs-slice-custom-form24
icon-wrapper23
lightbox-inner22
data-slice-typenavigation22
li21
sqs-slide-wrapperdata-slide-typecover-page20
socialstacked20
socialstackedtext-align-left20
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page20
lightbox-content19
button-style-outline19
countdown-contentdata-formatnumeric18
sqs-slice-album-playlist17
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
tracks16
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
data-slice-typebody15
gallery-video-background14
sqs-modal-lightbox-open13
ahoversqs-slide-wrapperdata-slide-typecover-page13
p13
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
social-icons-style-solid12
lisqs-slide-wrapperdata-slide-typecover-page12
icon-wrapperhover12
actionsnotstacked12
0px12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
password-style-rectangle11
actionsstacked11
sqs-slide-layer-contentsqs-slide-wrapperdata-slide-typecover-page11
password-style-underlined11
data-slice-typetwitter11
countdown-contentdata-formattextual11
data-slice-typetwitternotdata-compound-type10
solid10
all10
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
0ms10
horizontal-positioning-leftalignment-left10
horizontal-positioning-leftalignment-right10
horizontal-positioning-rightalignment-right10
squarespace10
sqs-slice-groupbottom-full-widthsqs-slide-wrapperdata-slide-typecover-page10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
110
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
applepodcast9
tidal9
soundcloud9
facebook9
spotify9
email9
dropbox9
stitcher9
dribbble9
stumbleupon9
thedots9
codepen9
tumblr9
behance9
ease-in-out-moz-transitionbackground-color9
ease-in-out-ms-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
bandsintown9
youtube9
twitch9
yelp9
vsco9
twitter9
vine9
vevo9
vimeo9
fivehundredpix9
snapchat9
pinterest9
instagram9
max-width600pxsqs-slide-wrapperdata-slide-typecover-page9
linkedin9
imdb9
medium9
houzz9
horizontal-positioning-rightalignment-center9
meetup9
horizontal-positioning-leftalignment-center9
flickr9
google9
itunes9
googleplay9
smugmug9
foursquare9
rss9
github9
reddit9
goodreads9
rdio9
ease-in-outtransitionbackground-color9
horizontal-positioning-rightalignment-left8
ulsqs-slide-wrapperdata-slide-typecover-page8
data-slice-typealbumhover8
sqs-slide-layer-contentmargin08
sqs-slice-play-buttonicon-wrapper8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
show-track-title7
track7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
video-icon-style-border7
social-icons-style-border7
data-slice-typemap7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
alignment-right7
spansqs-slide-wrapperdata-slide-typecover-page7
input-wrappernothidden7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
sqs-slide-layer-content7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
button-style-outlinesqs-modal-lightbox7
audio-player-icons-style-solid6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
autosqs-slide-wrapperdata-slide-typecover-page6
sqs-slice-play-buttonicon-wrapperhover6
track-progress-bar6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
social-icons-style-regular6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
audio-player-icons-style-border6
alignment-center6
ulstacked6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
10px6
2em6
button-style-raised6
input-wrapper6
rdiohover5
pinteresthover5
01s5
meetuphover5
reddithover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
mediumhover5
linkedinhover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
lock-style-regular5
smugmughover5
100ms5
vevohover5
twitterhover5
vinehover5
vscohover5
twitchhover5
yelphover5
youtubehover5
tumblrhover5
ease-outopacity5
tidalhover5
snapchathover5
thedotshover5
stumbleuponhover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
social-icons-style-knockout5
stitcherhover5
squarespacehover5
spotifyhover5
vimeohover5
soundcloudhover5
ituneshover5
rsshover5
instagramhover5
githubhover5
svgsocial-webkit-transitionbackground-color5
dropboxhover5
6px5
emailhover5
audio-player-icons-style-regular5
codepenhover5
facebookhover5
fivehundredpixhover5
behancehover5
button-shape-pill5
flickrhover5
bandsintownhover5
foursquarehover5
sqs-slice-album-playlistplaying5
dribbblehover5
googlehover5
houzzhover5
gm-style-cc5
applepodcasthover5
button-shape-rounded-corners5
imdbhover5
googleplayhover5
gmnoprint5
tweet-timestamp5
goodreadshover5
neuearialsans-seriffont-weight400font-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
4px4
track-title4
icon-wrapperwidth24pxheight24pxmargin04
tweet-body4
displaytablesqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-solid4
video-icon-style-regular4
map-style-minimal-dark4
audio-player-icons-style-knockout4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
5px4
7px3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-regular3
60px3
arrow-icon3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
lock-style-solid3
8px3
data-slice-typegallerysqs-gallery-grid3
lock-style-knockout3
social-icons-size-largesocial-icons-style-regular3
social-icons-size-smallsocial-icons-style-regular3
14px3
social-icons-size-mediumsocial-icons-style-regular3
fffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
video-icon-style-knockout3
icon-wrapperwidth36pxheight36pxmargin03
social-icons-size-extra-smallsocial-icons-style-regular3
tweet-avatar3
easesqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
responsive-wrapper3
screen3
horizontal-positioning-right3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
responsive-wrappernotstacked3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
only3
horizontal-positioning-left3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-album-playliststacked3
sqs-slice-album-playlistdemo-album3
sqs-slidesqs-slide-animation-ready3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
sqs-modal-lightbox3
button-play-pause3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containernotauto-image-background-color3
tweet-display-name3
tweet-handle3
responsive-wrapperstackedtext-align-center3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
autoflex13
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
captcha-container-wrapper3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-border3
button-style-solid3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
3px3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill000sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth32pxheight32pxmargin03
icon-wrapperborder2px3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-solid3
disclaimer-containersqs-slide-wrapperdata-slide-typecover-page3
ease-in-o-transitionopacity3
ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity3
countdown-unit3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
ease-in-out-moz-transitioncolor3
1px3
ease-in-out-ms-transitioncolor3
ease-in-out-o-transitioncolor3
ease-in-outtransitioncolor3
social-icons-size-extra-smallsocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
ease-intransitionopacity3
gallery-video-backgroundmobile3
social-icons-size-extra-largesocial-icons-style-solid3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-knockout3
social-icons-size-extra-largesocial-icons-style-border3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-solid3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-border3
data-slice-typeheadingnotdata-compound-type3
social-icons-size-mediumsocial-icons-style-solid3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-knockout3
max-width1020pxsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3

Evanfarmer.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Evanfarmer.net is a scam?

Websites with Similar Names

Evanfalbaum.com
Moviesauce | Professional Video Production | | TX & LA
Evanfarley.com
EVAN FARLEY
Evanfarmer.net
EVAN FARMER
Evanfashion.com
一分钟快三app_一分快三彩票【信誉首选】
Evanfeinberg.com
つくる技術だけではなく経営理念をもつこと/Successful Bakery Startup
Evanfeldman.com
Conductor | Evan Feldman - Conductor & Educator | United States
Evanfell.com
Evan Fell – Website Design & Development
Evanferrell.com
Evan Ferrell – Artist & Storyteller
Evanferrellstudio.com
Evan Ferrell Studio - In the Process
Evanfest.com
EVANFEST | LaxGiving for children in need

Recently Updated Websites

Platoconstruction.org 2 seconds ago.Knightconstructionco.com 3 seconds ago.Genting33.com 3 seconds ago.Viewfromseed.com 3 seconds ago.Shannuowh.com 3 seconds ago.Verticetrainingcenter.com 5 seconds ago.Xn--rlsv16awi2b.jp 5 seconds ago.Webnician.net 7 seconds ago.Majlajfbeauty.com 7 seconds ago.Parailleurs-paysagistes.com 7 seconds ago.Tobyam.com 7 seconds ago.Innerdesign.com 7 seconds ago.Yokosoindia.com 8 seconds ago.Moloko-dmitrov.ru 8 seconds ago.Rentalmobiljakarta.com 9 seconds ago.Sapo.vn 9 seconds ago.Bcis.org.uk 10 seconds ago.Myibiza.tv 10 seconds ago.Needapotty.com 10 seconds ago.Cloveryouth.jp 10 seconds ago.Bbook.jp 11 seconds ago.Spkowalowa.pl 11 seconds ago.Passionlifechurch.com 12 seconds ago.Gillenterpriseslondon.com 13 seconds ago.V9755.com 13 seconds ago.Allforadoll.com 13 seconds ago.79house.net 14 seconds ago.Enclaveatlakesofprosper.com 14 seconds ago.Liveoaksgc.com 14 seconds ago.Shyhdz.com 15 seconds ago.