Expedia.co.id  |  Paket Wisata: Pemesanan Hotel, Penerbangan & Akomodasi | Expedia.co.id
Low trust score  | 
Expedia menawarkan pengalaman memesan hotel secara online terbaik. Dapatkan hotel terbaik dan harga murah di agen perjalanan online terbesar di dunia!




Expedia.co.id Website Information

Website Ranks & Scores for Expedia.co.id

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:131,054
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:39%
DMOZ DMOZ Listing:No

Who hosts Expedia.co.id?

Expedia.co.id is hosted by NeuStar, Inc. in United States.
Expedia.co.id has an IP Address of 204.74.99.101 and a hostname of 204.74.99.101 and runs openresty/1.9.3.1 web server.



Expedia.co.id Web Server Information

Hosted IP Address:204.74.99.101
Hosted Hostname:204.74.99.101
Service Provider:NeuStar, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:openresty/1.9.3.1

HTTP Header Analysis for Expedia.co.id

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
activity-id:
Content-Encoding: gzip
Content-Language: in-ID
Content-Type: text/html;charset=UTF-8
P3P: CP="This is not a P3P policy! See http://www.expedia.co.id/privacy for more info."
Server: openresty/1.5.11.1
Vary: Accept-Encoding
X-UA-Compatible: IE=Edge
Content-Length: 21209
Date: Tue, 07 Jul 2015 07:26:21 GMT
Connection: keep-alive
X-EdgeConnect-Cache-Status: 0


Need to find out who hosts Expedia.co.id?

Expedia.co.id Free SEO Report

Website Inpage Analysis for Expedia.co.id

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Expedia.co.id

tanggalvarkembali ke areaandadisaccountdevpostfixkembali kesaccountareatombolitemditutup kembaliarg0 dariarg1sekarang ditutupuntukke areaarg0atausekarang ditutup kembalitelahditutupsekarangsbrandeapidkembaliifyangdanmemilihhalamankedarisaatdevditutup kembali ke

Longtail Keyword Density for Expedia.co.id

KeywordsOccurences
kembali ke area3
ditutup kembali ke3
sekarang ditutup kembali3
arg0 dari3
ke area3
kembali ke3
ditutup kembali3
sekarang ditutup3
dari10
arg08
sbrandeapid7
telah6
sekarang6
if5
var5
ke5
untuk5
tombol4
di4
item4
anda4
tanggal4
yang4
memilih4
halaman4
ditutup3
area3
kembali3
dev3
atau3
saat3
dan3
saccount3
saccountdevpostfix3
arg13

What are the nameservers for expedia.co.id?


Expedia.co.id Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Expedia.co.id is a scam?