Express.de - Aktuelle Nachrichten aus Köln, der Welt sowie Neues vom Sport und der Welt der Promis.

Express - Aktuelle Nachrichten aus Köln, der Welt sowie Neues vom Sport und der Welt der Promis.


Domain summary

SafetyLow trust score
Year Founded
2020
Global Traffic Rank
13,056
Estimated Worth
$1,054,080
Last updated
2020-10-16
Domain label
express
Domain extension
de
Statvoo Rating
C
Estimated daily income
$1,464
Estimated monthly income
$44,530

Frequently Asked Questions (FAQ)

Q: When was Express.de registered?
A: Express.de was registered 1 year, 8 months, 2 weeks, 3 days, 14 hours, 45 minutes, 37 seconds ago on Friday, October 16, 2020.
Q: When was the WHOIS for Express.de last updated?
A: The WHOIS entry was last updated 4 years, 9 months, 3 weeks, 5 days, 14 hours, 45 minutes, 37 seconds ago on Wednesday, September 6, 2017.
Q: What are Express.de's nameservers?
A: DNS for Express.de is provided by the following nameservers:
  • ns.udag.de
  • ns.udag.net
  • ns.udag.org
Q: Who is the registrar for the Express.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Express.de?
A: Express.de ranks 13,056 globally on Alexa. Express.de has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Express.de each day?
A: Express.de receives approximately 121,960 visitors and 731,760 page impressions per day.
Q: What IP address does Express.de resolve to?
A: Express.de resolves to the IPv4 address 35.190.48.80.
Q: In what country are Express.de servers located in?
A: Express.de has servers located in the United States.
Q: What webserver software does Express.de use?
A: Express.de is powered by Shield webserver.
Q: Who hosts Express.de?
A: Express.de is hosted by Merit Network Inc. in California, Mountain View, United States, 94043.
Q: How much is Express.de worth?
A: Express.de has an estimated worth of $1,054,080. An average daily income of approximately $1,464, which is roughly $44,530 per month.

Express.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Express.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Express.de

H1 Headings

1 :
  1. Express.de Aktuelle Nachrichten aus Köln, der Welt sowie Neues vom Sport und der Welt der Promis.

H2 Headings

11 :
  1. Politik & Wirtschaft
  2. Panorama
  3. Promi & Show
  4. Shoppingwelt
  5. Sport FUSSBALL 1. FC Köln Borussia Fortuna Düsseldorf Kölner Haie
  6. Im Westen Bonn Düsseldorf Essen Duisburg Wuppertal Dortmund Bochum Gelsenkirchen
  7. Köln
  8. Trending Now
  9. Leben Finanzen Gesundheit Familie Digital Reise Motor Liebesberatung Sex-Beratung Verbraucher
  10. Unsere Sonderthemen
  11. Witz des Tages

H3 Headings

78 :
  1. Köln steht still: Verdi knallhart: Nächster KVB-Streik auf mehrere Tage ausgeweitet
  2. Köln steht still: Verdi knallhart: Nächster KVB-Streik auf mehrere Tage ausgeweitet
  3. Nach schwachen Länderspielen: Stefan Effenberg bringt Nachfolger für Jogi Löw ins Spiel
  4. Bei Pocher: Wendler-Manager Krampe: Michael und Laura haben nach Telefonat geweint
  5. Dschungelcamp 2021: Zoe, Filip, Harald – 7 Kandidaten sollen bereits feststehen
  6. Corona-Risikogebiet Köln: Inzidenzwert steigt wieder rasant – neue Regeln ab Freitag?
  7. Köln war seine Heimat: Impfstoff fast fertig: Rettet dieser Arzt die Welt vor Corona?
  8. Kritischer 50er-Wert erreicht: Bonn jetzt offiziell Corona-Risikogebiet
  9. „Erinnere mich nicht“: Donald Trump weicht bei TV-Auftritt brisanter Frage aus
  10. Kauf-4-zahl-3-Aktion bei Amazon: 4 Beauty- und Drogerie-Produkte wählen, nur 3 bezahlen
  11. „Es reicht”: Nach „Bachelorette”-Auftakt: Pietro Lombardi stinksauer auf Melissa
  12. Großeinsatz in Münster: Geiselnahme in Gefängnis – Täter bei Zugriff gestorben
  13. Der etwas andere Käpitän: Hector: Euro-Held, FC-Jubilar und nun Ex-Nationalspieler
  14. Ob sich da jemand meldet?: Polizei in Bremen sucht Koffer-Besitzer – Inhalt ist brisant
  15. Mit Ronaldo im Tausch?: Juventus plant 400-Millionen-Euro-Angebot für Mbappe
  16. Eine Hommage an den Kölner Dom und Andy Warhol: Kunstplakat von Cornel Wachter
  17. Furchtbare Qual: Mädchen (8) wird zum Trampolinspringen gezwungen, bis sie tot umfällt
  18. Fahrzeit deutlich verkürzt: NRW-Stadt erstmals mit direkter ICE-Verbindung nach Berlin
  19. Youtuber (23) vor Gericht: Illegales Autorennen? Urteil von Kölner Richter überrascht
  20. Terror-Hilfe, Kinderpornos, Erpressung: Die dunkle Welt des IS-Gefährders aus Köln (18)
  21. Mein Gott, ist er bescheiden: Trump stapelt tief und verbreitet Falschaussagen
  22. Erdnuss statt Cashew: Rückruf von beliebtem Aufstrich – Gefahr für Allergiker
  23. Frau starb bei Horror-Crash: Hat sich Lambo-Raser Ramsy Azakir ins Ausland abgesetzt?
  24. Corona aktuell: RKI vermeldet erneut Rekord bei Neuinfektionen
  25. Lage ernst, aber...: Virologe Streeck hat klare Meinung zu Corona-Lage und Maßnahmen
  26. „Kein Höschen erforderlich”: So sexy sieht Jessica Simpson nach drei Kindern aus
  27. „Höhle der Löwen“: Gründer lassen Deal mit Judith Williams nach der Sendung platzen
  28. „The Voice”: Als Samu Haber einen Spruch bringt, herrscht plötzlich betretene Stille
  29. Playmobil Angebote: Bis zu 45% auf hochwertige Playmobil-Spielsets sparen
  30. Bis zu 98% Rabatt bei Eis.de: Auf Erotikprodukte & Sextoys im Sale, z.B. Satisfyer Men
  31. EXPRESS-Lotto24-Deal: 57 Mio. Eurojackpot – 3 Felder für nur 2,60 € statt 6,60 €
  32. GladbachLIVE: Zu hohe Inzidenz: Tausende Zuschauer dürfen nun doch nicht zum Heimspiel
  33. GladbachLIVE: Kuriose Anstoßzeit: Warum die Fohlen plötzlich um 20.30 Uhr ranmüssen
  34. Negativ-Rekord droht: Nur ein FC-Trainer durfte länger nicht gewinnen als Gisdol
  35. 2014 war der Klub noch Meister: Ex-Weltmeister-Trainer wechselt in Zweite Liga
  36. „Das zeigt, wie unser Kapitän ist“: Hector beendet DFB-Karriere aus privaten Gründen
  37. „War nicht immer fair“: Rückkehrer Sörensen über sein Auf und Ab beim FC
  38. Debüt-Doppelpack von Choupo-Moting: Bayern-B-Elf schlägt mutige Dürener im DFB-Pokal
  39. FC-Personalien: Gisdol weiter ohne zwei Leistungsträger – Routinier bricht ab
  40. Köln droht Geisterpiel: FC-Boss Wehrle: „Versteht in der Bevölkerung auch keiner“
  41. Dummer Zufall auf A52: Böse Überraschung für dreisten Stinkefinger-Drängler
  42. Wieder Warnstreik: Nichts geht mehr bei Bussen und Bahnen der Stadtwerke Bonn
  43. Therme in Duisburg: Es hagelt Beschwerden: Knappe Bikinis bei Frauen tabu
  44. Regeln in NRW: Corona-Gipfel: Laschet entscheidet heute über schärferen Kurs
  45. Anzeigen und Knöllchen: Harte Bilanz bei Corona-Verstößen in NRW: 51.000 Leute bestraft
  46. Land in Schranken gewiesen: NRW-Urlauber kippt umstrittenes Beherbergungsverbot
  47. Bekannt durch Raab-Show: Lisa Loch in Düsseldorf vor Gericht – es ging um 8927 Euro
  48. „Aktenzeichen XY": Gebissen, verprügelt und abgestochen: Wer ist der Mann auf dem Foto?
  49. Irre Flucht bis Rheinbach: Drogen, polizeibekannt, keinen Lappen – Fahrer wieder frei
  50. Bonner Innenstadt: Seit Donnerstag ist Karstadt in der Poststraße Geschichte
  51. Corona in Düsseldorf: Über 500 Masken-Schilder werden jetzt aufgehängt
  52. Bergisch Gladbach: Zoff: Anwohner (58) von Mann genervt – da zückt er die Gartenschere
  53. Video-Premiere: Comeback? „Callas von Niehl" verhilft Kölner Sänger zum Hit
  54. Nach Schwarzfahrer-Rekord: Niederländer in Köln unterwegs: Er bringt es auf den Punkt
  55. Prominente erste Preisträgerin: Stadt Köln und Festkomitee mit neuer Auszeichnung
  56. Chaos um Beherbergungsverbot: Kölner Hotelierin zieht jetzt Corona-Konsequenzen
  57. Köln steht still: Verdi knallhart: Nächster KVB-Streik auf mehrere Tage ausgeweitet
  58. Adventmitspielkonzert: Höhner spielen im Kölner Dom – eine Sache ist diesmal anders
  59. Der etwas andere Käpitän: Hector: Euro-Held, FC-Jubilar und nun Ex-Nationalspieler
  60. „The Voice“-Coach : Samu Haber packt aus: Was lief einst mit Annemarie Eilfeld?
  61. Großeinsatz in Münster: Geiselnahme in Gefängnis – Täter bei Zugriff gestorben
  62. „Erinnere mich nicht“: Donald Trump weicht bei TV-Auftritt brisanter Frage aus
  63. Kritischer 50er-Wert erreicht: Bonn jetzt offiziell Corona-Risikogebiet
  64. Ein bisschen geht noch: Ist es gefährlich weiterzutanken, wenn es schon geklickt hat?
  65. Neue Hamsterkauf-Welle?: Discounter bestätigen: Ein Produkt ist wieder stärker gefragt
  66. Lokale Lieferengpässe, aber...: Angst um Grippe-Impfstoff: Jens Spahn spricht Klartext
  67. S Immobilienpartner: Leben im Mehrgenerationenhaus: Was spricht dafür?
  68. Kölner Wochenmärkte: Jrön, rut un wieß – mit Kohl gesunde Farbe auf den Teller bringen
  69. Klinik am Ring: Vor der OP schon das Ergebnis sehen
  70. KölnTakt: Maske? Ja sicher! Die neue KölnTakt ist da
  71. KVB: Mit dem SchöneFerien-Ticket erreichen Schüler bequem Ziele in ganz NRW
  72. Abocard: Gehen Sie mit FORUM BLAU auf Flusskreuzfahrt nach Holland
  73. LANXESS arena: Shows, Konzerte, Comedy: Endlich geht es wieder los!
  74. YourStart.de: Entdecke hier die Ausbildung, die zu dir passt
  75. Spielerisch die Welt erkunden: Eine Weltkarte der besonderen Art
  76. Leuchtende Kathedrale: Den Kölner Dom zum Strahlen bringen
  77. Express-Rabatt: Sparen Sie bares Geld bei jedem Einkauf mit unseren Gutscheinen
  78. Lach mal wieder!: Witz des Tages: „Was haben Frauen ...“

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

6 :

Total Images

103 :

Links - Internal

210:

Links - Internal (nofollow)

11:

Links - Outbound

34:

Keyword Cloud for Express.de

layerandere kpitn hectorelsedaausbildungsbrseaufnunnochimversionstehtdenkanneshierkln steht stillmehrere tage ausgeweitet50erwertnurcontentid teaserurlauchdatalayerpageauf dieteilenabden klnerim westenzumgehtwidthklnerkarnevalfalsestill verdinewsberduisburgnsportauf mehrerevor gerichtinhalt teilensngerkvbstreik aufhattrackingjsonparamname valuedatabonn jetztcontentideventdsseldorflivetickerabonnentenpolitikhashvaluehector euroheld fcjubilarwerden inhalt teilenshoweinfcjubilar und nunheightkritischersindetwas andere kpitnbreak caseklner domauf denseinefortuna dsseldorfdemkrampeamhaben1 fcgladbachlivedomzuschauerder etwaswerdenkritischer 50erwert erreichtvieleerreicht bonn2dmntagejeckesnetauf mehrere tageinhalt teilen urlfussballfcmitetwasstellenanzeigen immobilienmnsterdata layerbeimkpitn hector euroheldvorkpitn hectorexpressdewennteilen urltrackingjsonparamnameif singlevalueexpiressievergleichfollower aufsparenknallhart nchster4nrweine1 fc klnreisedatalayerauthorkandidatendesnchster kvbstreik aufeuroheld fcjubilarerreicht bonn jetztetwas anderedatalayerpagetypebeiwarfrgegenwurdekpitninhaltkritischer 50erwerterotikausgeweitetkvbstreikinsverdi knallhartpromigibtnchster kvbstreikverdi knallhart nchsterdumontsamu1nachmnchengladbachjetzt offiziell coronarisikogebiettrackingjsoneventfacebookjsnchsterhectornichtbonn jetzt offizielleinenundefinedcasecoronabis zuden klner domreturnnichtshaberpltzlichtrackingjsonlist1kopieren anzeigefunctionder usprsident3bereitsimmobilien0url zum kopierenexnationalspielervonifanzeigensteht stillsteht still verdistellenanzeigenkopieren klnklnmehrereaus klnwitzoffiziellbreakknallhart nchster kvbstreikvardochfollowersetnun exnationalspielerschonwieusprsidentanzeigetrackingjsonpagetypetrumpaus derbringtvaluejetztknnenparamnamefc klneuroheldoffiziell coronarisikogebietbonnseitmannwiederzum kopierengerichtdschungelcampwirtrauernborussiacoronarisikogebietteilen url zumdrohtpanoramaleverkusengisdolsamu haberlassenandere kpitnaus demsinglevaluekvbstreik auf mehrerediehector euroheldbismanahmenausumexpressurl zumstill verdi knallhartampteaserurljetzt offizielltage ausgeweitetkopierenurlzujonas50erwert erreichtwirtschaftdasweltkln stehtsichfortunadiesererreichtelse ifverdishoppingwelt50erwert erreicht bonnmehrere tagewerden inhaltalsderwestender etwas anderefcjubilarneuezum kopieren anzeigecontenturltruenwirddayssanderedie weltknallhartiststadterstillzum kopieren klntwitter

Longtail Keyword Density for Express.de

KeywordsOccurrences
url zum kopieren71
teilen url zum71
inhalt teilen url71
zum kopieren anzeige11
1 fc kln9
etwas andere kpitn4
andere kpitn hector4
kpitn hector euro-held4
hector euro-held fc-jubilar4
fc-jubilar und nun4
zum kopieren kln4
der etwas andere4
kvb-streik auf mehrere3
den klner dom3
mehrere tage ausgeweitet3
auf mehrere tage3
still verdi knallhart3
nchster kvb-streik auf3
knallhart nchster kvb-streik3
verdi knallhart nchster3
steht still verdi3
kln steht still3
jetzt offiziell corona-risikogebiet3
bonn jetzt offiziell3
erreicht bonn jetzt3
50er-wert erreicht bonn3
kritischer 50er-wert erreicht3
werden inhalt teilen3
zum kopieren71
url zum71
teilen url71
inhalt teilen71
kopieren anzeige11
1 fc9
fc kln9
break case5
kpitn hector4
fortuna dsseldorf4
nun ex-nationalspieler4
hector euro-held4
euro-held fc-jubilar4
andere kpitn4
etwas andere4
kopieren kln4
follower auf4
klner dom4
der etwas4
tage ausgeweitet3
mehrere tage3
auf mehrere3
data layer3
aus der3
der us-prsident3
aus dem3
nchster kvb-streik3
auf die3
den klner3
werden inhalt3
bis zu3
kvb-streik auf3
stellenanzeigen immobilien3
knallhart nchster3
kritischer 50er-wert3
else if3
contentid teaserurl3
if singlevalue3
trackingjsonparamname value3
aus kln3
samu haber3
die welt3
vor gericht3
50er-wert erreicht3
verdi knallhart3
erreicht bonn3
bonn jetzt3
jetzt offiziell3
offiziell corona-risikogebiet3
im westen3
kln steht3
steht still3
still verdi3
auf den3
zum80
url73
teilen72
inhalt72
kopieren71
der47
var43
die37
auf30
kln29
function25
if20
ber19
mit17
bei16
den15
sich14
014
dsseldorf14
ist14
im14
klner14
anzeige13
fr13
nach13
von13
es13
zu12
aus12
bonn11
fc11
nicht11
vor10
19
ein9
das9
wieder9
dem9
nun9
bis8
jetzt8
sie8
welt7
false7
return7
trackingjsonpagetype7
break7
value7
war7
singlevalue7
else7
werden7
eine6
wird6
gegen6
case6
hector6
karneval6
corona6
n6
abonnenten6
um6
sport6
news5
ex-nationalspieler5
erotik5
als5
seit5
width5
amp5
wie5
bringt5
immobilien5
des5
neue5
undefined5
contentid5
stellenanzeigen4
er4
reise4
nur4
geht4
sind4
gisdol4
fortuna4
corona-risikogebiet4
ab4
noch4
mehrere4
gericht4
fc-jubilar4
etwas4
euro-held4
truen4
haben4
dom4
hier4
kpitn4
nrw4
schon4
hat4
follower4
mann4
trackingjsonparamname4
s4
einen4
pltzlich4
auch4
expires4
jeckesnet4
andere4
height4
knallhart3
steht3
viele3
verdi3
still3
nchster3
js3
mnster3
days3
duisburg3
westen3
sparen3
tage3
vergleich3
jonas3
stadt3
manahmen3
trump3
us-prsident3
gibt3
layer3
datalayerpage3
da3
lassen3
am3
datalayerpagetype3
datalayerauthor3
wurde3
ausgeweitet3
witz3
kvb-streik3
shoppingwelt3
wenn3
wirtrauern3
trackingjsonlist13
show3
promi3
panorama3
bereits3
kandidaten3
23
dschungelcamp3
krampe3
ins3
teaserurl3
contenturl3
wirtschaft3
anzeigen3
twitter3
facebook3
33
paramname3
expressde3
express3
hashvalue3
version3
set3
knnen3
politik3
samu3
ausbildungsbrse3
snger3
43
liveticker3
nichts3
offiziell3
erreicht3
50er-wert3
kritischer3
kann3
dmn3
dieser3
seine3
doch3
haber3
zuschauer3
gladbachlive3
leverkusen3
mnchengladbach3
borussia3
fussball3
beim3
data3
droht3
event3
trackingjsonevent3
dumont3

Who hosts Express.de?

Express.de Hosting Provider Information

Hosted IP Address:35.190.48.80
Hosted Hostname:80.48.190.35.bc.googleusercontent.com
Service Provider:Merit Network Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:shield

Is "Merit Network Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6166%
GOOGLE
14.4366%
AS-26496-GO-DADDY-COM-LLC
3.5285%
NAMECHEAP-NET
3.2196%
AMAZON-AES
2.2918%
GoDaddy.com, LLC
2.0510%
UNIFIEDLAYER-AS-1
2.0307%
Fara Negar Pardaz Khuzestan
1.6758%
CONFLUENCE-NETWORK-INC
1.5015%
AMAZON-02
1.4722%
Merit Network Inc.
0.1104%

Express.de Domain Nameserver Information

HostIP AddressCountry
ns.udag.de 192.174.68.8
ns.udag.net 176.97.158.8
ns.udag.org 176.97.158.91

Websites with Similar Names

Expre55o.com
No such app
Expreaa-scripts.com
expreaa-scripts.com
Expreacherman.com
Notes From A Retired Preacher | A Grace Oasis; a fellowship of believers in eternal salvation by Grace alone through faith alone in Christ alone.
Expread.io
Expread
Expreaders.com
Megan Burns

Recently Updated Websites

Sanfrancisco.broadwayworld.com (11 seconds ago.)Ziongrovetrouthatchery.com (11 seconds ago.)Epaper.dfsc.com.cn (13 seconds ago.)Livingheritage.lincoln.ac.nz (15 seconds ago.)Dspcan.homestead.com (15 seconds ago.)Cosmeticsbytamia.shop (17 seconds ago.)Vintedstore.com (18 seconds ago.)Soon-link.com.tw (20 seconds ago.)Transfermarkt.com (21 seconds ago.)Plant-breeding-update.de (24 seconds ago.)Kazokunomikata.jp (24 seconds ago.)Vidifi.vn (24 seconds ago.)Wtfda.org (27 seconds ago.)Theenthusiasticamateur.org (27 seconds ago.)Rlocal.pro (30 seconds ago.)Guerrillasocialmediahq.com (33 seconds ago.)Cardstore.com (33 seconds ago.)U2swisshome.com (34 seconds ago.)Protoolbox.tech (34 seconds ago.)Southerntaxservices.com (36 seconds ago.)Flintrl.com (37 seconds ago.)Vyshyvanka.blox.ua (38 seconds ago.)Qlm.soton.ac.uk (39 seconds ago.)Gartentage-lindau.de (41 seconds ago.)Thebrainobservatory.org (41 seconds ago.)Fie-burkina.org (42 seconds ago.)Ecoluxelondon.org (43 seconds ago.)Newjerseysolar.net (43 seconds ago.)Hyundata.com (44 seconds ago.)Blackwomentowatch.com (44 seconds ago.)

Recently Searched Keywords

agree美少女 (1 second ago.)20 2019 bryan (1 second ago.)0 comments on the courage to change your married life! three effective and positive changes to redeem your marriage (1 second ago.)hellocanadatv (1 second ago.)hearing test (1 second ago.)cornelia de lange syndrome prognosis (2 seconds ago.)битрикс (2 seconds ago.)海德官方网站 (2 seconds ago.)0 modul348 (2 seconds ago.)dermatologie (3 seconds ago.)bike transport service (3 seconds ago.)eastaboga al (3 seconds ago.)webski kreator (5 seconds ago.)tdi110 td-module-meta-info (5 seconds ago.)jakie warunki naley (5 seconds ago.)house of stories marvel (5 seconds ago.)requisitos para publicar una aplicacion en google play (6 seconds ago.)tomtools (7 seconds ago.)dobrodružný (8 seconds ago.)data-item-display-mobileicon tcb-mm-text (8 seconds ago.)elementor-elementelementor-element-a663b64 (8 seconds ago.)storm worlds (9 seconds ago.)rm-rf command in linux (10 seconds ago.)переезд (10 seconds ago.)bars 10 (11 seconds ago.)watch nomadland germany (11 seconds ago.)shatabrick ra3 (12 seconds ago.)سكس هنتاي شرموطة تمص الزب الاسود الضخم porn xn (12 seconds ago.)jeff schaller chicago (13 seconds ago.)new lasting finish lip liner (14 seconds ago.)