Marketingové služby a služby externí asistentky - profi služby Vaší firmě

Safety: Low trust score
Year Founded: 2018
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-12-27
Category: This site has not been categorized yet

Nabízím služby v oblasti marketingu, administrativní práce, překlady textů z němčiny a do němčiny. Marketingové poradenství, správa webu nebo eshopu.


Domain summary

Domain label
exteras
Domain extension
cz
Domain registered:
2018-09-10
Domain updated:
2018-09-10
Domain expires:
2021-09-10
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is exteras.cz ranked relative to other sites:

Percentage of visits to exteras.cz from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Exteras.cz registered?
A: Exteras.cz was registered 2 years, 5 months, 3 weeks, 3 days, 5 hours, 41 minutes, 22 seconds ago on Monday, September 10, 2018.
Q: When was the WHOIS for Exteras.cz last updated?
A: The WHOIS entry was last updated 2 years, 5 months, 3 weeks, 3 days, 5 hours, 41 minutes, 22 seconds ago on Monday, September 10, 2018.
Q: What are Exteras.cz's nameservers?
A: DNS for Exteras.cz is provided by the following nameservers:
  • ns.forpsi.cz
  • ns.forpsi.net
  • ns.forpsi.it
Q: Who is the registrar for the Exteras.cz domain?
A: The domain has been registered at CZ-NIC.
Q: What is the traffic rank for Exteras.cz?
A: Exteras.cz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Exteras.cz each day?
A: Exteras.cz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Exteras.cz resolve to?
A: Exteras.cz resolves to the IPv4 address 81.2.195.60.
Q: In what country are Exteras.cz servers located in?
A: Exteras.cz has servers located in the Czech Republic.
Q: What webserver software does Exteras.cz use?
A: Exteras.cz is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Exteras.cz?
A: Exteras.cz is hosted by INTERNET CZ, a.s. in Jihocesky Kraj, Ktis, Czechia, 383 01.
Q: How much is Exteras.cz worth?
A: Exteras.cz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Exteras.cz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Exteras.cz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Exteras.cz

H1 Headings

1 :
  1. Nabízím

H2 Headings

3 :
  1. Ing. Veronika Příplatová
  2. Reference klientů
  3. Nové články na blogu

H3 Headings

4 :
  1. Marketingové služby
  2. Služby externí asistentky:
  3. Důvody delegování některých Vašich činností na mne:
  4. Můžete ode mne očekávat:

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-125888734-1

Links - Internal (nofollow)

0:

Keyword Cloud for Exteras.cz

14px important textalign1displayapodnormal important colorprofontstyle normal importantimportant fontsize 14pximportant sfsisubscribepopinnerveronikanormal importantvm14px importantvcenter important sfsisubscribepopinnerhelveticaarialsansserif importantco jedo nminycolorimportant textalign centerimportant fontstyleeimportant color 000000fontfamily helveticaarialsansserif importanttakcenterjsme2center importantfontstyle normaljenavar000000 importantnormal100 importantifcocolor 000000zkaznkyimportant paddingwidth 100color 000000 importantemailmarginslubytextalign center importantsfsishortcodecontainertextalign centerwidthshelveticaarialsansserif important fontstylejsoufunctionimportant colorfontsizefontfamily helveticaarialsansseriffeedtypemarketingovfontfamilyonminyimportantimportant fontsizese14pxing0dosfsisubscribepopinnerwidth 100 importantnmfontsize 14pxhelveticaarialsansserif000000textalignfontstylefontsize 14px importantreturnimportant textalignpadding000000 important fontsizeimportant fontstyle normal

Longtail Keyword Density for Exteras.cz

KeywordsOccurences
font-family helveticaarialsans-serif important7
important color 0000007
color 000000 important7
000000 important font-size7
important text-align center7
text-align center important7
helveticaarialsans-serif important font-style5
important font-style normal5
font-style normal important5
normal important color5
important font-size 14px5
font-size 14px important5
14px important text-align5
center important sfsisubscribepopinner5
width 100 important3
important sfsisubscribepopinner8
000000 important7
center important7
font-family helveticaarialsans-serif7
helveticaarialsans-serif important7
important color7
color 0000007
important font-size7
important text-align7
text-align center7
font-size 14px5
normal important5
font-style normal5
important font-style5
14px important5
do nminy3
important padding3
100 important3
width 1003
co je3
important48
na15
sfsisubscribepopinner9
s9
var8
je8
se7
center7
text-align7
font-size7
0000007
color7
helveticaarialsans-serif7
pro7
font-family7
06
email5
veronika5
do5
function5
15
ing5
if5
font-style5
normal5
co5
14px5
vm5
v4
nminy4
apod4
display3
o3
marketingov3
sluby3
jsou3
margin3
padding3
23
width3
feedtype3
return3
jsme3
nm3
e3
tak3
zkaznky3
sfsishortcodecontainer3

Who hosts Exteras.cz?

Exteras.cz Hosting Provider Information

Hosted IP Address:81.2.195.60
Hosted Hostname:d060wh.forpsi.com
Service Provider:INTERNET CZ, a.s.
Hosted Country:Czech RepublicCZ
Location Latitude:48.9167
Location Longitude:14.1333
Webserver Software:Microsoft-IIS/10.0

Is "INTERNET CZ, a.s." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
INTERNET CZ, a.s.
0.0535%

HTTP Header Analysis for Exteras.cz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
Server: Microsoft-IIS/10.0
X-Powered-By: ARR/3.0
X-Pingback: https://www.exteras.cz/xmlrpc.php
Link:; rel=shortlink
Date: Sun, 27 Dec 2020 20:45:54 GMT
Content-Length: 38274

Exteras.cz Domain Nameserver Information

HostIP AddressCountry
ns.forpsi.cz 81.2.209.185
ns.forpsi.net 81.2.194.130
ns.forpsi.it 95.110.254.165


Need to find out who hosts Exteras.cz?


Domain Registration (WhoIs) information for Exteras.cz

 % (c) 2006-2019 CZ.NIC, z.s.p.o.
%
% Intended use of supplied data and information
%
% Data contained in the domain name register, as well as information
% supplied through public information services of CZ.NIC association,
% are appointed only for purposes connected with Internet network
% administration and operation, or for the purpose of legal or other
% similar proceedings, in process as regards a matter connected
% particularly with holding and using a concrete domain name.
%
% Full text available at:
% http://www.nic.cz/page/306/intended-use-of-supplied-data-and-information/
%
% See also a search service at http://www.nic.cz/whois/
%
%
% Whoisd Server Version: 3.12.0
% Timestamp: Sun Dec 27 21:45:55 2020

domain: exteras.cz
registrant: FORPSI-3U8-S332218
nsset: FORPSI
keyset: FORPSI-KS-4W96DBKL
registrar: REG-INTERNET-CZ
registered: 10.09.2018 23:02:09
changed: 10.09.2018 23:20:21
expire: 10.09.2021

contact: FORPSI-3U8-S332218
org: Veronika Příplatová
name: Veronika Příplatová
address: Klenovice 163
address: Soběslav
address: 39201
address: CZ
registrar: REG-MOJEID
created: 15.09.2009 08:34:03
changed: 18.12.2013 20:22:08

nsset: FORPSI
nserver: ns.forpsi.net
nserver: ns.forpsi.cz (81.2.209.185, 2001:15e8:201:1::d1b9)
nserver: ns.forpsi.it
tech-c: FORPSI
registrar: REG-INTERNET-CZ
created: 01.10.2007 10:19:47
changed: 05.01.2016 11:50:14

contact: FORPSI
org: INTERNET CZ, a.s.
name: Stefano Cecconi
address: Ktiš 2
address: Ktiš
address: 38403
address: CZ
registrar: REG-INTERNET-CZ
created: 04.08.2008 14:42:08
changed: 15.05.2018 21:32:00

keyset: FORPSI-KS-4W96DBKL
dnskey: 257 3 10 AwEAAdKx6JqHCUNTnO2Iymvfak+LEMjk3cTunRAX8o/ocOOCfQ/fn+oAXNPMq66JjFku3AQCMwObldPhmef1U5oCai43zqEr63deO/9k47MwfUDpvIEaeqTVYxPteqY7t6H9bqD1uJt00f1ozSDXLtcl+PRxoA+AM6RSb2v/pZFN5BeZJWPyS445PeQEVw9U9FQ8Aho+psjxFzQsWH04EqyXV5+2I+Gwy2w8QzEJEo/7p/87MN++zcTbK4NmMzCw4asIBydra1GoQyE7962svub+HNhAfM+F1ssvNxSuulZBgpfdcYPn84mn2h58QZWwjl91gzFR+QGaVCxGFKN/zLnvMQk=
tech-c: FORPSI-KEYSET
registrar: REG-INTERNET-CZ
created: 10.09.2018 23:20:20

contact: FORPSI-KEYSET
org: INTERNET CZ, a.s.
name: Stefano Cecconi
address: Ktiš 2
address: Ktiš
address: 38403
address: CZ
registrar: REG-INTERNET-CZ
created: 12.12.2011 11:16:39
changed: 11.11.2019 10:05:22

Websites with Similar Names

Exter.org
exter.org Is for Sale
Exter.pro
exter.pro -&nbspThis website is for sale! -&nbspexter Resources and Information.
Extera.com
Extera web agency | Consulenza e sviluppo soluzioni web
Exteradirect.com
Telephone systems, handsets, headsets, data cabling, maintenance and more from Extera
Exteralu.com
404 Not Found
Exteras.cz
Marketingové služby a služby externí asistentky - profi služby Vaší firmě

Recently Updated Websites

Dogforums.com (41 minutes 27 seconds ago.)Mc.uz (50 minutes 41 seconds ago.)Telcoict.com.au (59 minutes 6 seconds ago.)Slsf.sa (1 hour 8 minutes ago.)Paintaroof.com.au (1 hour 15 minutes ago.)Dmi.nu (1 hour 29 minutes ago.)Pratititech.com (1 hour 42 minutes ago.)Easyaccessap.com (1 hour 48 minutes ago.)Viria.io (1 hour 49 minutes ago.)Yumzyx.com (1 hour 57 minutes ago.)Jira.percona.com (8 hours 25 minutes ago.)Letsenhance.io (9 hours 28 minutes ago.)Publicitarioscriativos.com (9 hours 28 minutes ago.)Cursodereiki.online (9 hours 32 minutes ago.)Vlxx.xyz (9 hours 41 minutes ago.)24sevenjobtalk.com (10 hours 26 minutes ago.)Pipsli.net (10 hours 36 minutes ago.)Forsna.com (10 hours 53 minutes ago.)Macnomed.com (11 hours 54 seconds ago.)Easyeducation22.com (11 hours 17 minutes ago.)Fantomcomics.com (11 hours 30 minutes ago.)Naimorrisftlauderdale.com (11 hours 30 minutes ago.)Wrightwritingservices.com (11 hours 30 minutes ago.)Virtualmall.discount (11 hours 30 minutes ago.)Scovills.gs (11 hours 30 minutes ago.)Tenbux.com (11 hours 30 minutes ago.)Dovelife.org (11 hours 30 minutes ago.)Learntheanimalslite.com (11 hours 31 minutes ago.)Bestsale.be (11 hours 31 minutes ago.)Zoomflashmob.com (11 hours 31 minutes ago.)

Recently Searched Keywords

detay grup batman (1 second ago.)detay grup elazığ (2 seconds ago.)nbsp27 (2 seconds ago.)detay grup mimarlık (3 seconds ago.)detay grup maltepe (4 seconds ago.)break (4 seconds ago.)detay grup maltepe (4 seconds ago.)detay grup lpg (6 seconds ago.)detay grup tuzla (7 seconds ago.)detay grup erzurum (8 seconds ago.)анаболизм (9 seconds ago.)domain help (12 seconds ago.)website help (16 seconds ago.)sie sicher (19 seconds ago.)bonus (19 seconds ago.)registra tu producto (21 seconds ago.)b color rgb45 (32 seconds ago.)pousada no centro de petropolis (34 seconds ago.)atelier carvalho bernau, (35 seconds ago.)azure (42 seconds ago.)mein aliexpress (44 seconds ago.)outras (47 seconds ago.)e n (47 seconds ago.)privacy gdpr (48 seconds ago.)positioning (49 seconds ago.)positioning (50 seconds ago.)false-positive (51 seconds ago.)get capital (52 seconds ago.)tank top (53 seconds ago.)feminine wipes ► (54 seconds ago.)