Factus.dk Website Information

Factus.dk has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 0, a Majestic Rank of 251,096, a Domain Authority of 15% and is not listed in DMOZ.

Factus.dk is hosted by Microsoft Corporation in Leinster, Dublin, Ireland, D02.
Factus.dk has an IP Address of 94.245.104.73 and a hostname of waws-prod-db3-001.cloudapp.net and runs Microsoft-IIS/8.0 web server.

The domain factus.dk was registered 201 decades 8 years 9 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for factus.dk

Full Whois Lookup for Factus.dk Whois Lookup

# Hello 2a01:7e00::f03c:91ff:fe84:f734. Your session has been logged.
#
# Copyright (c) 2002 - 2017 by DK Hostmaster A/S
#
# Version: 2.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: factus.dk
DNS: factus.dk
Registered: 2006-11-14
Expires: 2018-11-30
Registration period: 5 years
VID: no
Dnssec: Unsigned delegation
Status: Active

Nameservers
Hostname: ns1.unoeuro.com
Hostname: ns2.unoeuro.com
Hostname: ns3.unoeuro.com
Hostname: ns4.unoeuro.com

# Use option --show-handles to get handle information.
# Whois HELP for more help.

Who hosts Factus.dk?

Factus.dk Web Server Information

Hosted IP Address:94.245.104.73
Hosted Hostname:waws-prod-db3-001.cloudapp.net
Service Provider:Microsoft Corporation
Hosted Country:IrelandIE
Location Latitude:53.3331
Location Longitude:-6.2489
Webserver Software:Microsoft-IIS/8.0

HTTP Header Analysis for Factus.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Length: 113264
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.0
Content-Style-Type: text/css
Content-Script-Type: text/javascript
X-Powered-By: ASP.NET
Date: Wed, 23 Dec 2015 06:01:56 GMT


Need to find out who hosts Factus.dk?

Factus.dk Free SEO Report

Website Inpage Analysis for Factus.dk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Factus.dk

visualpostsdecember 10myyouxunitvisual studiocommentsstudiolinkstyledisplay none ifnetmorebutwriternone iflinkstyledisplay none2comments 0junelarsdecemberpostcategoryhasaappend1august4linkhrefiffebruarysite3indexjanuary 1testfebruary 1liveblogenginenetnone if linkhrefjanuarynotif linkhrefwindowsmelive writerlinkstyledisplaymarchmayjulynone

Longtail Keyword Density for Factus.dk

KeywordsOccurences
none if linkhref7
linkstyledisplay none if7
if linkhref8
linkstyledisplay none8
none if7
february 13
december 13
comments 03
visual studio3
january 13
live writer3
015
if12
linkhref8
linkstyledisplay8
none8
my6
test6
15
you5
25
35
lars4
february4
december4
windows4
live4
index4
site4
me4
net4
44
may4
june3
august3
post-categoryhasaappend3
comments3
writer3
but3
march3
january3
not3
blogenginenet3
studio3
july3
posts3
more3
xunit3
visual3

What are the nameservers for factus.dk?

Factus.dk Domain Nameserver Information

HostIP AddressCountry
ns1.unoeuro.com 46.36.215.2Czech Republic Czech Republic
ns3.unoeuro.com 83.217.78.186Belgium Belgium
ns4.unoeuro.com 85.159.211.233United Kingdom United Kingdom
ns2.unoeuro.com 93.191.156.2Denmark Denmark

Factus.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Factus.dk is a scam?