Fairview.org  |  
Low trust score  | 
Fairview Health Services, based in Minneapolis, is a nonprofit academic health system providing exceptional health care in each specialty and service that we offer. In partnership with the University of Minnesota, our 20,000 plus employees and 2,250 employed and aligned physicians embrace innovation and new thinking to provide greater value—hi...

Fairview.org Website Information

Website Ranks & Scores for Fairview.org

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:77,254
Majestic Rank Majestic Rank:76,565
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Whois information for fairview.org

Full Whois Lookup for Fairview.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Fairview.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D438440-LROR
Registrar WHOIS Server:
Registrar URL: http://www.networksolutions.com
Updated Date: 2017-08-10T07:21:55Z
Creation Date: 1995-10-10T04:00:00Z
Registry Expiry Date: 2022-10-09T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C21448350-LROR
Registrant Organization:
Registrant Street: 12808 Gran Bay Parkway West
Registrant Street: care of Network Solutions
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32258
Registrant Country: US
Registrant Phone: +1.5707088780
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C188609195-LROR
Admin Organization:
Admin Street: 12808 Gran Bay Parkway West
Admin Street: care of Network Solutions
Admin Street: PO Box 459
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32258
Admin Country: US
Admin Phone: +1.5707088780
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C188609195-LROR
Tech Organization:
Tech Street: 12808 Gran Bay Parkway West
Tech Street: care of Network Solutions
Tech Street: PO Box 459
Tech City: Jacksonville
Tech State/Province: FL
Tech Postal Code: 32258
Tech Country: US
Tech Phone: +1.5707088780
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-25T03:24:53Z

Who hosts Fairview.org?

Fairview.org is hosted by Fairview Health Services in Minnesota, Minneapolis, United States, 55413.
Fairview.org has an IP Address of and a hostname of www.clearscript.org.

Fairview.org Web Server Information

Hosted IP Address:
Hosted Hostname:www.clearscript.org
Service Provider:Fairview Health Services
Hosted Country:United StatesUS
Location Latitude:45.0023
Location Longitude:-93.2408
Webserver Software:unknown

HTTP Header Analysis for Fairview.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Age: 916
Date: Sun, 28 Jun 2015 08:40:29 GMT
Cache-Control: max-age=1800 ,s-maxage=1800
Content-Length: 16890
Connection: Keep-Alive
Via: NS-CACHE-10.0: 252
Last-Modified: Fri, 19 Jun 2015 10:20:00 GMT
Content-type: text/html; charset=UTF-8
ntCoent-Length: 65004
Content-Encoding: gzip

Need to find out who hosts Fairview.org?

Fairview.org Free SEO Report

Website Inpage Analysis for Fairview.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Fairview.org

cover backgroundattachmentprimary care clinicsbackgroundattachmentnear mespecialties solutionsseewant to findpregnancylearnmeviewcitiesprovidermedicinelike to seepatientspecialtiesexceptionalconditionsallneed immediate caresleepgo backbillcentersolutionsbackgroundmorecenter fairviewlookinglearn morehealth careimmediate carecenter norepeatnorepeatservices specialtiesurgent carefixed gofindexplorepediatricnorepeat backgroundsize coverprimary caresameday careid likebirthplaceneedyour communityonlinebackgroundattachment fixed goget startedspecialties solutions servicescenter norepeat backgroundsizeyoubackwereyourneed immediatefamilyprimaryfixed go backmymedical center fairviewhealthcover backgroundattachment fixedpediatric carepharmacynorepeat go backgocoverrightgetbackgroundsize cover backgroundattachmentcommunitypaywizardcontainerlossdoctorwizardwizard wizardcontainernearhospitalbirthlikeoncareclinicscenter center norepeatresourcescare clinicssamedaymedical centerhelpnorepeat backgroundsizewecenter centernbspdermatologystartedfairviewnorepeat goservicesmedicalnot1solutions servicesidimmediateurgentfamily medicinelocationstreatmentouraugusttodaysearchbill paymychartwant0patient resourcescenter norepeat goview allwant to exploreservices specialties solutionsspecialtybackgroundsizebackgroundsize coverbackgroundattachment fixedcarefixedvisionprovidersappointment

Longtail Keyword Density for Fairview.org

center center no-repeat10
center no-repeat background-size6
no-repeat background-size cover6
background-size cover background-attachment5
cover background-attachment fixed5
need immediate care4
medical center fairview4
center no-repeat go4
no-repeat go back4
fixed go back4
want to explore4
background-attachment fixed go4
like to see4
want to find4
specialties solutions services3
primary care clinics3
services specialties solutions3
center no-repeat10
center center10
learn more10
primary care8
go back8
view all8
background-size cover6
get started6
no-repeat background-size6
services specialties5
cover background-attachment5
background-attachment fixed5
wizard wizard-container5
urgent care4
same-day care4
need immediate4
near me4
no-repeat go4
center fairview4
medical center4
immediate care4
id like4
family medicine4
pediatric care4
your community4
fixed go4
bill pay4
health care4
patient resources3
specialties solutions3
care clinics3
solutions services3

What are the nameservers for fairview.org?

Fairview.org Domain Nameserver Information

HostIP AddressCountry
dns2.fairview.org States United States
dns1.fairview.org States United States

Fairview.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Fairview.org is a scam?