Familjeliv.se  |  FamiljeLiv.se
Low trust score  | 
Sveriges största mötesplats för vuxna, med fokus på familjelivet, förälder, graviditet och barn.




Familjeliv.se Website Information

Website Ranks & Scores for Familjeliv.se

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:31,385
Majestic Rank Majestic Rank:94,159
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Domain Information for Familjeliv.se

Domain Registrar: NIC-SE
Registration Date:2006-06-28  1 decade 2 years 10 months ago
Expiration Date:2016-06-28  2 years 10 months 3 weeks ago

Whois information for familjeliv.se

Full Whois Lookup for Familjeliv.se Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Familjeliv.se. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

# Copyright (c) 1997- IIS (The Internet Foundation In Sweden).
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: familjeliv.se
holder: modmod3626-00001
admin-c: -
tech-c: -
billing-c: -
created: 2006-06-28
modified: 2017-06-02
expires: 2018-06-28
transferred: 2015-12-21
nserver: gerald.ns.cloudflare.com
nserver: nora.ns.cloudflare.com
dnssec: unsigned delegation
status: ok
registrar: Loopia AB

Who hosts Familjeliv.se?

Familjeliv.se is hosted by Internet Border Technologies AB in Sweden.
Familjeliv.se has an IP Address of 81.201.212.20 and a hostname of btweb6.driften.net.



Familjeliv.se Web Server Information

Hosted IP Address:81.201.212.20
Hosted Hostname:btweb6.driften.net
Service Provider:Internet Border Technologies AB
Hosted Country:SwedenSE
Location Latitude:59.3294
Location Longitude:18.0686
Webserver Software:Not Applicable

HTTP Header Analysis for Familjeliv.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 18 Jun 2015 21:23:49 GMT
Server: Apache
X-Powered-By: PHP/5.4.16
Pragma: no-cache
X-Srv: 3
Content-Type: text/html; charset=UTF-8
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content-Encoding: gzip
X-Varnish: 622049266
Age: 0
Via: 1.1 varnish-v4
X-Cache: MISS
Transfer-Encoding: chunked
Connection: keep-alive
Accept-Ranges: bytes


Need to find out who hosts Familjeliv.se?

Familjeliv.se Free SEO Report

Website Inpage Analysis for Familjeliv.se

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Familjeliv.se

auto namenbspnbspnbspnbspnbspfunction varvrldenshrautoattharnamecontainersamarbete medsomdetrsamarbete med amfwindowmflloadadformadpanorama4subcattill2truecbmestdigfamiljelivsehsteninnehllviamfplanershyar barngamflsessiontimesendelsemed amf fonderpageviewavatt ffonderif windowmfldebuggasetpingvetaenkeltkanmerfrdet romstartvillett enkeltfrnsamarbetefr attigngfwindowmflcontenttrackercountermed amfvrigtwindowmflcontenttrackingvarminaelse ifamf fonderbarnhr rduplanershyarcmdwindowaddeventlistenerjqueryloaded1spwindowaddeventlistenerjqueryloaded functionfunctionampsettimeoutfunctionettochjaggacreatefrgafrldshyergreventforumif windowmflcontenttrackingfamiljelivmedifwindowmfldebug0

Longtail Keyword Density for Familjeliv.se

KeywordsOccurences
med amf fonder6
samarbete med amf6
samarbete med10
amf fonder6
med amf6
auto name4
if windowmflcontenttracking3
windowaddeventlistenerjqueryloaded function3
if windowmfldebug3
else if3
function var3
hr r3
att f3
fr att3
det r3
planershyar barn3
ett enkelt3
if24
var22
att18
med17
function17
fr15
r13
barn13
och12
som11
du10
familjeliv10
samarbete10
p9
det9
09
amp8
s7
till7
ett6
fonder6
amf6
true6
15
25
vill5
om5
hr5
gacreate5
auto5
ping4
f4
nbspnbspnbspnbspnbsp4
event4
else4
pageview4
name4
start4
gaset4
igng4
vi4
mer4
mina4
innehll4
forum4
subcat4
container3
windowmflcontenttracking3
cb3
settimeoutfunction3
windowmfldebug3
windowmflcontenttrackercounter3
cmd3
gamflsessiontimesend3
veta3
frga3
frn3
hsten3
frldshyer3
planershyar3
jag3
dig3
vrigt3
enkelt3
gr3
av3
vrldens3
windowmflloadadformadpanorama43
mest3
har3
kan3
familjelivse3
windowaddeventlistenerjqueryloaded3

What are the nameservers for familjeliv.se?

Familjeliv.se Domain Nameserver Information

HostIP AddressCountry
dns04.ports.net 158.255.211.116Austria Austria
dns03.ports.se 94.237.33.102Finland Finland
dns01.dipcon.com 193.14.90.50Sweden Sweden

Familjeliv.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Familjeliv.se is a scam?