|  Free Family History and Genealogy Records —
High trust score  | 
Discover your family history. Explore the world’s largest collection of free family trees, genealogy records and resources. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:4,703
Majestic Rank Majestic Rank:3,205
Domain Authority Domain Authority:88%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D3449883-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-05-23T15:03:21Z
Creation Date: 1998-06-25T04:00:00Z
Registry Expiry Date: 2018-06-24T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Key-Systems GmbH
Registrar IANA ID: 269
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Registry Registrant ID: C117551174-LROR
Registrant Name: Intellectual Reserve, Inc.
Registrant Organization: Intellectual Reserve, Inc.
Registrant Street: 50 East North Temple Street
Registrant City: Salt Lake City
Registrant State/Province: Utah
Registrant Postal Code: 84150-0018
Registrant Country: US
Registrant Phone: +1.8012403959
Registrant Phone Ext:
Registrant Fax: +1.8012401187
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C117551174-LROR
Admin Name: Intellectual Reserve, Inc.
Admin Organization: Intellectual Reserve, Inc.
Admin Street: 50 East North Temple Street
Admin City: Salt Lake City
Admin State/Province: Utah
Admin Postal Code: 84150-0018
Admin Country: US
Admin Phone: +1.8012403959
Admin Phone Ext:
Admin Fax: +1.8012401187
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C117551174-LROR
Tech Name: Intellectual Reserve, Inc.
Tech Organization: Intellectual Reserve, Inc.
Tech Street: 50 East North Temple Street
Tech City: Salt Lake City
Tech State/Province: Utah
Tech Postal Code: 84150-0018
Tech Country: US
Tech Phone: +1.8012403959
Tech Phone Ext:
Tech Fax: +1.8012401187
Tech Fax Ext:
Tech Email: Login to show email
Server: NS-1481.AWSDNS-57.ORG
Name Server: NS-285.AWSDNS-35.COM
Name Server: NS-757.AWSDNS-30.NET
Name Server: NS-1938.AWSDNS-50.CO.UK
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-24T12:29:31Z

Who hosts is hosted by Genealogical Society of Utah in Utah, Salt Lake City, United States, 84150. has an IP Address of and a hostname of and runs Cowboy web server. Web Server Information

Hosted IP Address:
Service Provider:Genealogical Society of Utah
Hosted Country:United StatesUS
Location Latitude:40.7712
Location Longitude:-111.889
Webserver Software:Cowboy
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Cowboy
Connection: close
Content-Type: text/html; charset=utf-8
Etag: "-1456642791"
Vary: Accept-Encoding
Content-Encoding: gzip
Date: Mon, 08 Jun 2015 19:00:22 GMT
Transfer-Encoding: chunked
Via: 1.1 vegur
Access-Control-Allow-Methods: OPTIONS, HEAD, GET, PUT, POST, DELETE
Access-Control-Allow-Headers: accept, accept-charset, accept-encoding, accept-language, accept-datetime, authorization, connection, content-encoding, content-length, content-md5, content-type, date, expect, from, host, if-match, if-modified-since, if-none-match, if-range, if-unmodified-since, location, origin, range, referer, singularityjsheader, te, user-agent, warning, x-expect-override, x-reason, x-requested-with, x-fs-feature-tag, x-correlationid
Access-Control-Expose-Headers: location, link, warning, x-entity-id, content-location, x-processing-time, retry-after, x-fs-page-context, allow
Access-Control-Allow-Origin: *
Access-Control-Max-Age: 604800

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

headers accept applicationjsoniffsshowexmboxremovejqueryobjectmorebrowseryougethelpcampaignmboxajaxcallnullancestorsopenurlyour familyfamily historyacceptaddmodalerrormakeonlinesharecampaignmboxajaxcallcountrycampaignmboxurlaccept applicationjsonfsanalyticsdeferpageviewsearchreturnheaderscampaignipajaxcallvarinformationapplicationjsonresponsefamily treetreeheaders acceptpreserveget startedrecordsyourhistorymemoriesstartedtrackpageviewfamilyfsxhrgetlearnbooklethistorical recordslearn moreiffamily bookletfindnonmembernulltryusertyperelsevolunteeryour family historyhistoricalindexingfunctionusertyper nonmember

Longtail Keyword Density for

headers accept applicationjson4
your family history3
family tree7
your family6
accept applicationjson4
headers accept4
historical records4
get started4
family booklet4
usertyper nonmember3
family history3
learn more3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States DNS Record Analysis DNS Lookup

Serial: 1
Refresh: 7200
Retry: 900
Expire: 1209600
familysearch.orgMX3600Priority: 10
familysearch.orgMX3600Priority: 10
familysearch.orgTXT3600TXT: MS=ms62285318
familysearch.orgTXT3600TXT: google-site-verification=6KKVYhlRvHTViW2
familysearch.orgTXT3600TXT: v=spf1 ip4: ip4:
ip4: ip4:
ip4: ip4:
ip4: ~all

Alexa Traffic Rank for

Alexa Search Engine Traffic for