Fastighetsvarlden.se Favicon Fastighetsvarlden.se

Fastighetsvarlden.se Website Thumbnail
Checking...
Fastighetsvärlden
Low trust score
 | 
Add a review Change category Claim this site
Fastighetsbranschens nyhetsbyrå. Först med det viktigaste inom transaktioner, uthyrningar, projekt och rekryteringar.


Domain summary

Domain label
fastighetsvarlden
Domain extension
se
Domain registered:
1996-09-06
Domain updated:
2020-10-21
Domain expires:
2020-12-31
Global Traffic Rank
826,787
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Rank summary

How is fastighetsvarlden.se ranked relative to other sites:

Percentage of visits to fastighetsvarlden.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Fastighetsvarlden.se registered?
A: Fastighetsvarlden.se was registered 24 years, 1 month, 3 weeks, 4 days, 1 hour, 26 minutes, 39 seconds ago on Friday, September 6, 1996.
Q: When was the WHOIS for Fastighetsvarlden.se last updated?
A: The WHOIS entry was last updated 1 week, 4 days, 1 hour, 26 minutes, 39 seconds ago on Wednesday, October 21, 2020.
Q: What are Fastighetsvarlden.se's nameservers?
A: DNS for Fastighetsvarlden.se is provided by the following nameservers:
  • ns.bahnhof.se
  • ns2.bahnhof.net
Q: Who is the registrar for the Fastighetsvarlden.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Fastighetsvarlden.se?
A: Fastighetsvarlden.se ranks 826,787 globally on Alexa. Fastighetsvarlden.se has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Fastighetsvarlden.se each day?
A: Fastighetsvarlden.se receives approximately 1,064 visitors and 2,128 page impressions per day.
Q: What IP address does Fastighetsvarlden.se resolve to?
A: Fastighetsvarlden.se resolves to the IPv4 address 213.80.96.177.
Q: In what country are Fastighetsvarlden.se servers located in?
A: Fastighetsvarlden.se has servers located in the Sweden.
Q: What webserver software does Fastighetsvarlden.se use?
A: Fastighetsvarlden.se is powered by Varnish webserver.
Q: Who hosts Fastighetsvarlden.se?
A: Fastighetsvarlden.se is hosted by Bahnhof Internet AB in Stockholm, Bromma, Sweden, 161 00.
Q: How much is Fastighetsvarlden.se worth?
A: Fastighetsvarlden.se has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Who hosts Fastighetsvarlden.se?

Fastighetsvarlden.se Hosting Provider Information

Hosted IP Address:213.80.96.177
Hosted Hostname:h-213-80-96-177.NA.cust.bahnhof.se
Service Provider:Bahnhof Internet AB
Hosted Country:SwedenSE
Location Latitude:59.35
Location Longitude:17.9167
Webserver Software:Varnish

Is "Bahnhof Internet AB" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Fastighetsvarlden.se

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 21 Oct 2020 02:18:07 GMT
Server: Varnish
X-Varnish: 33693537
Location: https://www.fastighetsvarlden.se/
Content-Length: 0
Connection: keep-alive

Fastighetsvarlden.se Domain Nameserver Information

HostIP AddressCountry
ns.bahnhof.se 195.178.160.1Sweden Sweden
ns2.bahnhof.net 212.85.64.4Sweden Sweden


Need to find out who hosts Fastighetsvarlden.se?


Domain Registration (WhoIs) information for Fastighetsvarlden.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: fastighetsvarlden.se
holder: wiltid8636-00001
admin-c: -
tech-c: -
billing-c: -
created: 1996-09-06
modified: 2019-12-02
expires: 2020-12-31
transferred: 2019-02-13
nserver: ns.bahnhof.se
nserver: ns2.bahnhof.net
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: Loopia AB

Fastighetsvarlden.se Free SEO Report

Website Inpage Analysis for Fastighetsvarlden.se

H1 Headings

2 :
  1. Missa inget – skriv upp dig idag!
  2. Missa inget – skriv upp dig idag!

H2 Headings

56 :
  1. FV 06/2020
  2. Fastighetsvärlden Idag
  3. Nyheter
  4. Analys & Fakta
  5. Fokus
  6. Jobb & Karriär
  7. Seminarier
  8. Butik
  9. Om Fastighetsvärlden
  10. Logistea nästan i mål med affären för 841 miljoner
  11. Redo för ny storflytt – kan lämna Hagastaden
  12. 50 Mäktigaste 2020: Idag platserna 20–22
  13. Smäll för Steen & Ström när Åhléns stänger ännu mer
  14. Skebo och Dahlgrens gör bytesaffär
  15. Victoria Park och Peab bygger nytt i Kållered
  16. Tibco Software utökar till 2.700 kvm hos Wallenstam
  17. Senaste nyheterna
  18. JM tillträder byggrätt för nytt HK - se nya bilder
  19. Vill sälja portfölj med nio fastigheter
  20. ”Kontor kommer att behövas mer än någonsin”
  21. Buden på Gasklockan – vilka har råd med projektet?
  22. CA tvingas göra halt vid Gasverkstomten
  23. Henrik Nordlöf blir vice vd vid I am Home
  24. Mofast vill köpa åtta 08-fastigheter från Celon
  25. Peabs fastighetsbolag Annehem debuterar i december
  26. Veckans mest lästa
  27. Vill sälja och lämna – kanske går skapa byggrätter
  28. Mannheimer Swartling flyttar till NCC:s nya
  29. Fiaskot: Inte ett enda bud på miljardcentrum
  30. Tidigare folkhemsjätten planerar fler nedläggningar
  31. Långläsning: Så överlevde Wallenstam krisen
  32. Inläggsnavigering
  33. Senaste nyheterna
  34. Kommande seminarier
  35. 50 Mäktigaste 2020
  36. 20 största ägarna i CBD
  37. Vill bli störst
  38. Vad kan du om lokala kungar?
  39. 20 största uthyrningarna 2020
  40. Veckans mest lästa
  41. Största affärerna 2020
  42. FV Quiz: Vad kan du om Ilija Batljan?
  43. Första huvudkontoret som bara vill väl
  44. Nytt på FV Jobb
  45. Studieresa till Landskrona?
  46. 50 största ägarna 2020
  47. FV Quiz: Nördtest (Lätt)
  48. Planerar för nästa steg
  49. På nytt jobb
  50. Happy days are here again
  51. Kundtjänst
  52. Prenumerationsärenden magasin
  53. Seminarieärenden
  54. Besöksadress
  55. Prenumerera
  56. Annonsera

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

102 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-21136982-1

Links - Internal

131:
  1. Fastighetsvarlden Om Fastighetsvärlden
    https://www.fastighetsvarlden.se/om-fastighetsvarlden/
  2. Fastighetsvarlden Kontakt
    https://www.fastighetsvarlden.se/om-fastighetsvarlden/redaktion/
  3. Fastighetsvarlden Annonsera
    https://www.fastighetsvarlden.se/annonsera-i-tidningen-och-pa-webben/
  4. https://www.fastighetsvarlden.se
    https://www.fastighetsvarlden.se
  5. https://www.fastighetsvarlden.se/butik/produkt-kategori/tidningen/losnummer/fv-06-2020/
    https://www.fastighetsvarlden.se/butik/produkt-kategori/tidningen/losnummer/fv-06-2020/
  6. Fastighetsvarlden Beställ nu!
    https://www.fastighetsvarlden.se/butik/produkt-kategori/tidningen/losnummer/fv-06-2020/
  7. https://www.fastighetsvarlden.se/butik/produkt-kategori/nyhetsbrev/fastighetsvarlden-idag/
    https://www.fastighetsvarlden.se/butik/produkt-kategori/nyhetsbrev/fastighetsvarlden-idag/
  8. Fastighetsvarlden Beställ nu!
    https://www.fastighetsvarlden.se/butik/produkt-kategori/nyhetsbrev/fastighetsvarlden-idag/
  9. Fastighetsvarlden Nyheter
    https://www.fastighetsvarlden.se
  10. Fastighetsvarlden Analys & Fakta
    https://www.fastighetsvarlden.se/analys-fakta/
  11. Fastighetsvarlden Fokus
    https://www.fastighetsvarlden.se/fokus/
  12. Fastighetsvarlden Jobb & Karriär
    https://www.fastighetsvarlden.se/jobb/
  13. Fastighetsvarlden Seminarier
    https://www.fastighetsvarlden.se/seminarier/
  14. Fastighetsvarlden Butik
    https://www.fastighetsvarlden.se/butik/
  15. Fastighetsvarlden Registrera
    https://www.fastighetsvarlden.se/registrera
  16. Fastighetsvarlden Konto
    https://www.fastighetsvarlden.se/mitt-konto/
  17. Fastighetsvarlden Logga ut
    https://www.fastighetsvarlden.se/mitt-konto/customer-logout/?_wpnonce=be3db6c4c4
  18. Fastighetsvarlden Logga in
    https://www.fastighetsvarlden.se/mitt-konto/
  19. Fastighetsvarlden Topplistor
    https://www.fastighetsvarlden.se/analys-fakta/topplistor/
  20. Fastighetsvarlden Affärsanalyser
    https://www.fastighetsvarlden.se/analys-fakta/affarsanalyser/
  21. Fastighetsvarlden 50 Mäktigaste
    https://www.fastighetsvarlden.se/analys-fakta/50-maktigaste/
  22. Fastighetsvarlden Porträtt
    https://www.fastighetsvarlden.se/fokus/portratt/
  23. Fastighetsvarlden Projekt
    https://www.fastighetsvarlden.se/fokus/projekt/
  24. Fastighetsvarlden Krönikor
    https://www.fastighetsvarlden.se/fokus/kronikor/
  25. Fastighetsvarlden FV-Quiz
    https://www.fastighetsvarlden.se/quiz/
  26. Fastighetsvarlden Lediga jobb
    https://www.fastighetsvarlden.se/jobb/
  27. Fastighetsvarlden Personnytt
    https://www.fastighetsvarlden.se/karriar/personnytt/
  28. Fastighetsvarlden Persontoppen
    https://www.fastighetsvarlden.se/karriar/persontoppen/
  29. Fastighetsvarlden • Annonsera tjänst
    https://www.fastighetsvarlden.se/annonsera-jobb/
  30. Fastighetsvarlden Aktuella seminarier
    https://www.fastighetsvarlden.se/seminarier/
  31. Fastighetsvarlden • Bli samarbetspartner
    https://www.fastighetsvarlden.se/samarbetspartner-seminarie/
  32. Fastighetsvarlden Prenumerera på magasinet
    https://www.fastighetsvarlden.se/butik/produkt-kategori/tidningen/prenumeration/helarsprenumeration/
  33. Fastighetsvarlden Prenumerera på nyhetsbrevet
    https://www.fastighetsvarlden.se/butik/produkt-kategori/nyhetsbrev/fastighetsvarlden-idag/
  34. Fastighetsvarlden Lösnummer
    https://www.fastighetsvarlden.se/produkt-kategori/tidningen/losnummer/
  35. Fastighetsvarlden Indikatorn
    https://www.fastighetsvarlden.se/produkt-kategori/fastighetsindikatorn/
  36. Fastighetsvarlden Jubileumsutgåva
    https://www.fastighetsvarlden.se/butik/produkt-kategori/tidningen/losnummer/jubileumsutgava-1986-2016/
  37. Fastighetsvarlden Redaktion/kontakt
    https://www.fastighetsvarlden.se/om-fastighetsvarlden/redaktionen/
  38. Fastighetsvarlden Integritetspolicy
    https://www.fastighetsvarlden.se/integritetspolicy/
  39. Fastighetsvarlden Om cookies
    https://www.fastighetsvarlden.se/om-fastighetsvarlden/om-cookies/
  40. Fastighetsvarlden NYTT – 25 nov: Kontorsdagen 2020
    https://www.fastighetsvarlden.se/seminarier/kontorsdagen-2020/
  41. Fastighetsvarlden 16 nov: Köpcentrum & Butiker 2020
    https://www.fastighetsvarlden.se/seminarier/kopcentrum-butiker-2020/
  42. Fastighetsvarlden 50 Mäktigaste 2020 – nedräkning pågår!
    https://www.fastighetsvarlden.se/analys-fakta/50-maktigaste/50-maktigaste-2020/
  43. Fastighetsvarlden Logistea nästan i mål med affären för 841 miljoner Försäljningsprocessen pausades i början av pendemin. Nu är parterna nästan i mål.
    https://www.fastighetsvarlden.se/notiser/logistea-i-mal-med-stor-forsaljning-till-blackstone/
  44. Fastighetsvarlden Redo för ny storflytt – kan lämna Hagastaden Kan göra ännu en stor samlokalisering.
    https://www.fastighetsvarlden.se/notiser/redo-for-ny-storflytt-kan-lamna-hagastaden/
  45. Fastighetsvarlden 50 Mäktigaste 50 Mäktigaste 2020: Idag platserna 20–22 För 15:e året har fastighets- och byggbranschen röstat fram vem som anses Mäktigast.
    https://www.fastighetsvarlden.se/analys-fakta/50-maktigaste/50-maktigaste-2020/
  46. Fastighetsvarlden Smäll för Steen & Ström när Åhléns stänger ännu mer Fortsätter att krympa beståndet.
    https://www.fastighetsvarlden.se/notiser/ahlens-stanger-ytterligare-varuhus/
  47. Fastighetsvarlden Skebo och Dahlgrens gör bytesaffär Enligt förslaget förvärvas del av kvarteret Kapella av Skebo, medan fastigheten Ringduvan 8 inklusive Blomstergårdarna säljs till Dahlgrens. – Det …
    https://www.fastighetsvarlden.se/notiser/skebo-och-dahlgrens-gor-bytesaffar/
  48. Fastighetsvarlden Victoria Park och Peab bygger nytt i Kållered Under våren startar byggnationen för de första 92 hyresrätterna i Kållered som byggs av Peab på uppdrag av beställaren Victoria …
    https://www.fastighetsvarlden.se/notiser/peab-och-victoria-park-bygger-nytt-i-kallered/
  49. Fastighetsvarlden Tibco Software utökar till 2.700 kvm hos Wallenstam TIBCO Software utökar sin lokalyta på Första Långgatan i Göteborg och hyr ytterligare 900 kvadratmeter. Sammantaget utökas lokalytan till nästan …
    https://www.fastighetsvarlden.se/notiser/tibco-software-utokar-till-2-700-kvm-hos-wallenstam/
  50. Fastighetsvarlden Logistea nästan i mål med affären för 841 miljoner
    https://www.fastighetsvarlden.se/notiser/logistea-i-mal-med-stor-forsaljning-till-blackstone/
  51. Fastighetsvarlden Redo för ny storflytt – kan lämna Hagastaden
    https://www.fastighetsvarlden.se/notiser/redo-for-ny-storflytt-kan-lamna-hagastaden/
  52. Fastighetsvarlden Skebo och Dahlgrens gör bytesaffär
    https://www.fastighetsvarlden.se/notiser/skebo-och-dahlgrens-gor-bytesaffar/
  53. Fastighetsvarlden Smäll för Steen & Ström när Åhléns stänger ännu mer
    https://www.fastighetsvarlden.se/notiser/ahlens-stanger-ytterligare-varuhus/
  54. Fastighetsvarlden Victoria Park och Peab bygger nytt i Kållered
    https://www.fastighetsvarlden.se/notiser/peab-och-victoria-park-bygger-nytt-i-kallered/
  55. Fastighetsvarlden Tibco Software utökar till 2.700 kvm hos Wallenstam
    https://www.fastighetsvarlden.se/notiser/tibco-software-utokar-till-2-700-kvm-hos-wallenstam/
  56. Fastighetsvarlden JM tillträder byggrätt för nytt HK - se nya bilder
    https://www.fastighetsvarlden.se/notiser/jm-tilltrader-byggratt-for-nytt-hk-for-190-miljoner/
  57. Fastighetsvarlden Se fler nyheter
    https://www.fastighetsvarlden.se/arkivet
  58. Fastighetsvarlden JM tillträder byggrätt för nytt HK - se nya bilder FV avslöjade planerna för fem år sedan. Nu är det dags för byggstart. En tredjedel ska hyras ut externt.
    https://www.fastighetsvarlden.se/notiser/jm-tilltrader-byggratt-for-nytt-hk-for-190-miljoner/
  59. Fastighetsvarlden Vill sälja portfölj med nio fastigheter Läs om säljaren och vilka fastigheter som berörs.
    https://www.fastighetsvarlden.se/notiser/midroc-contracting-vill-salja-portfolj-med-nio-fastigheter/
  60. Fastighetsvarlden ”Kontor kommer att behövas mer än någonsin” Fabeges Stefan Dahlbo om framtiden.
    https://www.fastighetsvarlden.se/notiser/var-overtygelse-ar-att-kontor-kommer-att-behovas-mer-an-nagonsin/
  61. Fastighetsvarlden Buden på Gasklockan – vilka har råd med projektet? Budtiden har gått ut. FV berättar om vad som händer de kommande månaderna.
    https://www.fastighetsvarlden.se/notiser/besked-om-gasklockan-i-december/
  62. Fastighetsvarlden CA tvingas göra halt vid Gasverkstomten Vd Johan Damne berättar för FV vad som hänt.
    https://www.fastighetsvarlden.se/notiser/ca-tvingas-gora-halt-vid-gasverkstomten/
  63. Fastighetsvarlden Henrik Nordlöf blir vice vd vid I am Home Under året har I am Home haft en kraftig tillväxt med samarbeten som Rikshem och Heimstaden. Den starka position som …
    https://www.fastighetsvarlden.se/notiser/henrik-nordlof-blir-vice-vd-vid-i-am-home/
  64. Fastighetsvarlden Mofast vill köpa åtta 08-fastigheter från Celon Mälardalens Omsorgsfastigheter Holding AB (Mofast) har ingått en avsiktsförklaring med det Stockholmsbaserade fastighetsbolaget Celon AB om förvärv av en fastighetsportfölj om …
    https://www.fastighetsvarlden.se/notiser/mofast-koper-atta-08-fastigheter-fran-celon/
  65. Fastighetsvarlden Peabs fastighetsbolag Annehem debuterar i december Peab avser att notera B-aktierna i Annehem Fastigheter på Nasdaq Stockholm under december 2020. Det framgår av en kallelse till …
    https://www.fastighetsvarlden.se/notiser/peabs-fastighetsbolag-annehem-debuterar-i-december/
  66. Fastighetsvarlden McDonalds stänger ytterligare tre centrala restauranger
    https://www.fastighetsvarlden.se/notiser/mcdonalds-stanger-ytterligare-tre-centrala/
  67. Fastighetsvarlden Fiaskot: Inte ett enda bud på Vällingby C – skjuts fram
    https://www.fastighetsvarlden.se/notiser/fiaskot-inte-ett-enda-bud-pa-vallingby-c-skjuts-upp/
  68. Fastighetsvarlden 50 Mäktigaste 2020
    https://www.fastighetsvarlden.se/analys-fakta/50-maktigaste/50-maktigaste-2020/
  69. Fastighetsvarlden Åhléns vill fortsätta justera beståndet framåt
    https://www.fastighetsvarlden.se/notiser/ahlens-fortsatter-justera-bestandet-framat/
  70. Fastighetsvarlden SBB förvärvar vårdfastigheter för 2,3 miljarder
    https://www.fastighetsvarlden.se/notiser/sbb-forvarvar-vardfastigheter-for-23-miljarder/
  71. Fastighetsvarlden NCC lockar Mannheimer Swartling till nya Våghuset
    https://www.fastighetsvarlden.se/notiser/ncc-lockar-mannheimer-swartling-till-nya-vaghuset/
  72. Fastighetsvarlden Internationell kontorskänsla när Scius projekt tar form
    https://www.fastighetsvarlden.se/notiser/fenix-sthlm-scius-satsning-i-hagastaden/
  73. Fastighetsvarlden Vill sälja och lämna – kanske går skapa byggrätter Ytterligare en större affär mitt på Kungsholmen kan vänta.
    https://www.fastighetsvarlden.se/notiser/regionen-kan-salja-stora-landstingshuset-pa-kungsholmen/
  74. Fastighetsvarlden Mannheimer Swartling flyttar till NCC:s nya Hyr de tre översta våningarna i spektakulärt projekt.
    https://www.fastighetsvarlden.se/notiser/ncc-lockar-mannheimer-swartling-till-nya-vaghuset/
  75. Fastighetsvarlden Fiaskot: Inte ett enda bud på miljardcentrum Fastighetsvärlden berättar varför den tänkta storaffären faller. Har fått kalla handen från investerarna. Säljaren förlänger tidsfristen med hela ett år.
    https://www.fastighetsvarlden.se/notiser/fiaskot-inte-ett-enda-bud-pa-vallingby-c-skjuts-upp/
  76. Fastighetsvarlden Tidigare folkhemsjätten planerar fler nedläggningar Tiden har sprungit i kapp kedjan som överlevt sig själv – krympt med 75 procent sedan storhetstiden.
    https://www.fastighetsvarlden.se/notiser/ahlens-fortsatter-justera-bestandet-framat/
  77. Fastighetsvarlden Långläsning: Så överlevde Wallenstam krisen I den nyutgivna boken ”Mot alla odds” berättar Hans Wallenstam om en av de mest dramatiska perioderna i Sveriges moderna historia – 90-talskrisen. FV bjuder på ett smakprov ur boken, där läsaren kastas in mitt i stormens öga.
    https://www.fastighetsvarlden.se/notiser/sa-overlevde-wallenstam-krisen/
  78. Fastighetsvarlden 2
    https://www.fastighetsvarlden.se/page/2/
  79. Fastighetsvarlden 3
    https://www.fastighetsvarlden.se/page/3/
  80. Fastighetsvarlden 4
    https://www.fastighetsvarlden.se/page/4/
  81. Fastighetsvarlden 587
    https://www.fastighetsvarlden.se/page/587/
  82. Fastighetsvarlden Nästa sida
    https://www.fastighetsvarlden.se/page/2/
  83. Fastighetsvarlden nov16 Köpcentrum & Butiker 2020 Webbsänt seminarium
    https://www.fastighetsvarlden.se/seminarier/kopcentrum-butiker-2020/
  84. Fastighetsvarlden nov25 Kontorsdagen 2020 Webbsänt seminarium
    https://www.fastighetsvarlden.se/seminarier/kontorsdagen-2020/
  85. Fastighetsvarlden dec01 Samhällsfastigheter 2020 Stockholm
    https://www.fastighetsvarlden.se/seminarier/samhallsfastigheter-2020/
  86. Fastighetsvarlden Aktuella seminarier
    https://www.fastighetsvarlden.se/seminarier
  87. Fastighetsvarlden 50 Mäktigaste 50 Mäktigaste 2020 För 15:e året har fastighets- och byggbranschen röstat fram vem som anses Mäktigast.
    https://www.fastighetsvarlden.se/analys-fakta/50-maktigaste/50-maktigaste-2020/
  88. Fastighetsvarlden Topplista 20 största ägarna i CBD Stockholms city präglas av stabilitet och långsiktighet men även av flera stora stadsomvandlingsprojekt.
    https://www.fastighetsvarlden.se/analys-fakta/topplistor/20-storsta-agarna-i-cbd/
  89. Fastighetsvarlden PORTRÄTT Vill bli störst Utmanare. Sofia Ljungdahl är ny på jobbet mitt under brinnande pandemi. Uppdraget är tydligt utpekat: Obos ska utmana bostadsjättarna på allvar – i de största svenska städerna.
    https://www.fastighetsvarlden.se/fokus/portratt/vill-bli-storst/
  90. Fastighetsvarlden FV Quiz Vad kan du om lokala kungar? Har du koll på vad som händer runt om i landet?
    https://www.fastighetsvarlden.se/quiz/fv-quiz-vad-kan-du-om-lokala-kungar/
  91. Fastighetsvarlden Topplista 20 största uthyrningarna 2020 Fastighetsvärlden listar här de största uthyrningarna under 2020.
    https://www.fastighetsvarlden.se/analys-fakta/topplistor/storsta-uthyrningarna-2020/
  92. Fastighetsvarlden Topplista Största affärerna 2020 FV har här sammanställt de hittills största fastighetstransaktionerna under 2020. Vi berättar även vilka rådgivare som varit inblandade.
    https://www.fastighetsvarlden.se/analys-fakta/topplistor/storsta-affarerna-2020/
  93. Fastighetsvarlden Quiz FV Quiz: Vad kan du om Ilija Batljan? Testa dina kunskaper om en av branschens mest färgstarka profiler.
    https://www.fastighetsvarlden.se/quiz/fv-quiz-vad-kan-du-om-ilija-batljan/
  94. Fastighetsvarlden Projekt Första huvudkontoret som bara vill väl Det var 2018 års största uthyrning. FV publicerar nu nya illustrationer.
    https://www.fastighetsvarlden.se/fokus/projekt/forsta-huvudkontoret-som-bara-vill-val/
  95. Fastighetsvarlden Teknisk förvaltare Stockholms Stift
    https://www.fastighetsvarlden.se/jobb/teknisk-forvaltare-21/
  96. Fastighetsvarlden SigtunaHem söker två Projektledare SigtunaHem
    https://www.fastighetsvarlden.se/jobb/sigtunahem-soker-tva-projektledare/
  97. Fastighetsvarlden Asset Managers till SAIAB SAIAB
    https://www.fastighetsvarlden.se/jobb/saiab-soker-tva-asset-managers/
  98. Fastighetsvarlden Associate till Cavendo Cavendo
    https://www.fastighetsvarlden.se/jobb/associate-till-cavendo/
  99. Fastighetsvarlden Fastighetsansvarig till Västermalms församling Västermalms församling
    https://www.fastighetsvarlden.se/jobb/fastighetsansvarig-till-vastermalms-forsamling/
  100. Fastighetsvarlden Fastighetsutvecklingschef till RO Properties RO Properties
    https://www.fastighetsvarlden.se/jobb/fastighetsutvecklingschef-till-ro-properties/
  101. Fastighetsvarlden Managing Director / Projektutvecklare Abylon AB
    https://www.fastighetsvarlden.se/jobb/managing-director-projektutvecklare/
  102. Fastighetsvarlden Projektledare till Vectura Vectura
    https://www.fastighetsvarlden.se/jobb/projektledare-till-vectura/
  103. Fastighetsvarlden Teknisk förvaltare ICA Fastigheter AB
    https://www.fastighetsvarlden.se/jobb/teknisk-forvaltare-20/
  104. Fastighetsvarlden Förvaltningsassistent Willhem Göteborg AB
    https://www.fastighetsvarlden.se/jobb/forvaltningsassistent-7/
  105. Fastighetsvarlden Energi- och teknikkoordinator Corem Property Group
    https://www.fastighetsvarlden.se/jobb/energi-och-teknikkoordinator/
  106. Fastighetsvarlden SBAB söker erfaren Fastighetsvärderare SBAB
    https://www.fastighetsvarlden.se/jobb/sbab-soker-erfaren-fastighetsvarderare/
  107. Fastighetsvarlden Redovisningsansvarig Turbinen
    https://www.fastighetsvarlden.se/jobb/redovisningsansvarig-3/
  108. Fastighetsvarlden Projektledare Nordier
    https://www.fastighetsvarlden.se/jobb/projektledare-24/
  109. Fastighetsvarlden Affärsdriven Projektutvecklare till Fondamentor Fondamentor Fastigheter
    https://www.fastighetsvarlden.se/jobb/affarsdriven-projektutvecklare-till-fondamentor/
  110. Fastighetsvarlden Fastighetsförvaltare till Corem Property... Corem Property Group
    https://www.fastighetsvarlden.se/jobb/fastighetsforvaltare-till-corem-property-group/
  111. Fastighetsvarlden Analyst to Aareal Bank Aareal Bank
    https://www.fastighetsvarlden.se/jobb/analyst-to-aareal-bank/
  112. Fastighetsvarlden Drifttekniker Stiftelsen Kungälvsbostäder
    https://www.fastighetsvarlden.se/jobb/drifttekniker-28/
  113. Fastighetsvarlden Projektledare New Property
    https://www.fastighetsvarlden.se/jobb/projektledare-23/
  114. Fastighetsvarlden Se fler aktuella tjänster
    https://www.fastighetsvarlden.se/jobb/
  115. Fastighetsvarlden Krönika Studieresa till Landskrona? ”Det behövs helt nya, lång­siktiga grepp. Fastighets­ägarna borde till exempel börja bry sig.”
    https://www.fastighetsvarlden.se/fokus/kronikor/studieresa-till-landskrona/
  116. Fastighetsvarlden TOPPLISTA 50 största ägarna 2020 Fastighetsvärlden listar de 50 största fastighetsägarna.
    https://www.fastighetsvarlden.se/analys-fakta/topplistor/50-storsta-agarna-2020/
  117. Fastighetsvarlden QUIZ FV Quiz: Nördtest (Lätt) Testa dina kunskaper om fastigheterna i centrala Stockholm.
    https://www.fastighetsvarlden.se/quiz/fv-quiz-norden-fastighetsbeteckningar-latt/
  118. Fastighetsvarlden PORTRÄTT Planerar för nästa steg Beslutsam. Han förklarar framgången med att han varit väldigt naiv. Kanske är det lite av det vi alla behöver. Att inte väja för svårigheterna utan ladda med energi och sätta i gång. Hans skapelse Slättö har kommit en bra bit på vägen, men Johan Karlsson siktar högre.
    https://www.fastighetsvarlden.se/fokus/portratt/planerar-for-nasta-steg/
  119. https://www.fastighetsvarlden.se/karriar/personnytt/gar-fran-croisette-till-catella/
    https://www.fastighetsvarlden.se/karriar/personnytt/gar-fran-croisette-till-catella/
  120. https://www.fastighetsvarlden.se/karriar/personnytt/ny-vd-i-point-properties/
    https://www.fastighetsvarlden.se/karriar/personnytt/ny-vd-i-point-properties/
  121. https://www.fastighetsvarlden.se/karriar/personnytt/affarsomradeschef-till-sh-bygg/
    https://www.fastighetsvarlden.se/karriar/personnytt/affarsomradeschef-till-sh-bygg/
  122. https://www.fastighetsvarlden.se/karriar/personnytt/humlegarden-tillsatter-cfo/
    https://www.fastighetsvarlden.se/karriar/personnytt/humlegarden-tillsatter-cfo/
  123. https://www.fastighetsvarlden.se/karriar/personnytt/utses-till-coo-pa-causeywestling/
    https://www.fastighetsvarlden.se/karriar/personnytt/utses-till-coo-pa-causeywestling/
  124. https://www.fastighetsvarlden.se/karriar/personnytt/annordia-forstarker-inom-vardering/
    https://www.fastighetsvarlden.se/karriar/personnytt/annordia-forstarker-inom-vardering/
  125. Fastighetsvarlden Se fler som har bytt jobb
    https://www.fastighetsvarlden.se/karriar/personnytt/
  126. Fastighetsvarlden Krönika Happy days are here again ”Så snart allt återgår till det normala blir det business as usual.”
    https://www.fastighetsvarlden.se/fokus/kronikor/happy-days-are-here-again/
  127. Fastighetsvarlden Magasin
    https://www.fastighetsvarlden.se/butik/produkt-kategori/tidningen/prenumeration/prenumeration/
  128. Fastighetsvarlden Nyhetsbrev
    https://www.fastighetsvarlden.se/butik/produkt-kategori/nyhetsbrev/fastighetsvarlden-idag/
  129. Fastighetsvarlden Magasin & web
    https://www.fastighetsvarlden.se/annonsera-i-tidningen-och-pa-webben/
  130. Fastighetsvarlden FV Jobb
    https://www.fastighetsvarlden.se/annonsera-jobb/
  131. Fastighetsvarlden Samarbetspartner seminarier
    https://www.fastighetsvarlden.se/samarbetspartner-seminarie/

Links - Internal (nofollow)

0:

Links - Outbound

6:
  1. https://servedbyadbutler.com/redirect_alink.spark?ALID=11438&ID=165080
    https://servedbyadbutler.com/redirect_alink.spark?ALID=11438&ID=165080
  2. Fastighetsvarlden Tweets by Fastighetsv
    https://twitter.com/Fastighetsv?ref_src=twsrc%5Etfw
  3. https://twitter.com/fastighetsv
    https://twitter.com/fastighetsv
  4. https://www.instagram.com/fastighetsv/
    https://www.instagram.com/fastighetsv/
  5. https://www.linkedin.com/company/fastighetsv%C3%A4rlden
    https://www.linkedin.com/company/fastighetsv%C3%A4rlden
  6. https://www.facebook.com/fastighetsvarlden/
    https://www.facebook.com/fastighetsvarlden/

Links - Outbound (nofollow)

0:

Keyword Cloud for Fastighetsvarlden.se

dahlgrens gr bytesaffrparkkarrirfr steen4mltrue stype textjavascriptssrcdocumentwrite0 documentwrite adbutleradspushhandlerpeabopt opt placestorflyttsmllaffrennyttnytt hk se3textjavascriptssrc httpsservedbyadbutlercomappjsvar nkvm hos2ml med affrentill 2700 kvmutkar till 2700clickclickmacroplaceholder ifvad somrtilltrderadbutler adbutleradsbilderjm tilltrder byggrttdocumentcreateelementscriptnr hlnsn documentgetelementsbytagnamescript0hkhk ses documentcreateelementscript sasyncnnusmll frnroch dahlgrensdahlgrensclickclickmacroplaceholder if windowadbutlerfunctionvardetsasyncgrmktigastewallenstamfr nytttilltrder byggrtthlnskan lmnalmnakvm hos wallenstampeab bygger nyttavbyggrtt fr nytttruennu merstorflytt kanochlogistea nstanvar2700 kvmnubygger nyttsteen strmse nya bilderstrm nr hlnsn varadbutler adbutler adbutleradshlns stngerdomain servedbyadbutlercomkeywords abkw domainabkwhk se nyaif windowadbutlerfunctionvarvar abkwtrue stypevictorianparentnodeinsertbeforeswindowadbutlerfunctionvar s documentcreateelementscriptfr 841utkar tillmer6mktigaste 2020sewindowabkw varif windowadbutlerfunctionvar saffren fr 841placepadbutlerregister165080sasync trueomhttpsservedbyadbutlercomappjsvar nstrm nrhttpsservedbyadbutlercomappjsvar n documentgetelementsbytagnamescript02700 kvm hosabkw domainjm tilltrderskeywords abkwpeab bygger50 mktigastejmoch dahlgrens grstype textjavascriptssrc httpsservedbyadbutlercomappjsvarsteen strm nrse nyatibconparentnodeinsertbefores ndocumentgetelementsbytagnamescript0 nparentnodeinsertbefores nmed affren frsasync true stypeoch peabtibco softwarekanaffren frfr steen strmtextjavascriptssrcunderstnger nnu meradbutler adbutleradbutlerads adbutleradsnpark och peabkeywords7nyheterhttpsservedbyadbutlercomappjsvaradbutleradspushhandleradbutlerads varflerattoch peab byggervar abkw windowabkwportrttadbutler adbutlerads adbutleradsservedbyadbutlercom clickclickmacroplaceholder ifdocumentwrite adbutleradspushhandlerstorflytt kan lmnavar adbutlersmll fr steendocumentcreateelementscript sasyncbyggrttstngerbytesaffrnytt hkabkw domain servedbyadbutlercomstrm841 miljonersoftwarewindowadbutlerfunctionvar sberttarhagastadenutadbutlerads var abkwnstansoftware utkardomain servedbyadbutlercom clickclickmacroplaceholdersteenstypevillytterligareredologgaopt optwindowabkwn documentgetelementsbytagnamescript0 nparentnodeinsertbeforeshlns stnger nnunyadahlgrens gradbutlerads adbutlerads varnstan i mlett0 documentwriteskebo och dahlgrensstype textjavascriptssrcfrdocumentgetelementsbytagnamescript0frnoptlogisteafr 841 miljonerdocumentcreateelementscript sasync truegr bytesaffrseminarierfr ny storflyttskeboservedbyadbutlercomhos wallenstam8clickclickmacroplaceholderabkw windowabkwn var adbutlerny storflyttbyggrtt frnya bilderservedbyadbutlercom clickclickmacroplaceholdervictoria park ochdocumentwrite adbutleradspushhandler functionoptny storflytt kan0hosiftextjavascriptssrc httpsservedbyadbutlercomappjsvarvictoria parktilltrder byggrtt frjobbhartillfr nytt hktill 2700ml meddocumentgetelementsbytagnamescript0 nparentnodeinsertbefores50 mktigaste 2020domainsoftware utkar tillpark och5fr nyutkarmiljonerossvadnr hlns stngerfunctionoptadbutleradspushhandler functionoptnyfastigheteradbutlerredo fr nymed affrenbyggervar adbutler adbutlerkan lmna hagastadenfastighetsvrlden1abkw windowabkw varfvdenklleredopt placenparentnodeinsertbefores n varadbutleradsprojektkvmsomtibco software utkarskebo ochfunctionopt adbutlerregister165080redo frs documentcreateelementscriptstnger nnulmna hagastadenwindowadbutlerfunctionvarnytt i klleredadbutleradspushhandler functionopt adbutlerregister165080med

Longtail Keyword Density for Fastighetsvarlden.se

KeywordsOccurences
if windowadbutlerfunctionvar s13
adbutler adbutlerads adbutlerads13
windowadbutlerfunctionvar s documentcreateelementscript13
domain servedbyadbutlercom clickclickmacroplaceholder13
abkw domain servedbyadbutlercom13
opt opt place13
adbutleradspushhandler functionopt adbutlerregister16508013
documentwrite adbutleradspushhandler functionopt13
0 documentwrite adbutleradspushhandler13
abkw windowabkw var13
var abkw windowabkw13
adbutlerads var abkw13
adbutlerads adbutlerads var13
keywords abkw domain13
adbutler adbutler adbutlerads13
stype textjavascriptssrc httpsservedbyadbutlercomappjsvar13
s documentcreateelementscript sasync13
var adbutler adbutler13
sasync true stype13
true stype textjavascriptssrc13
documentcreateelementscript sasync true13
textjavascriptssrc httpsservedbyadbutlercomappjsvar n13
n var adbutler13
n documentgetelementsbytagnamescript0 nparentnodeinsertbefores13
documentgetelementsbytagnamescript0 nparentnodeinsertbefores n13
httpsservedbyadbutlercomappjsvar n documentgetelementsbytagnamescript013
nparentnodeinsertbefores n var13
servedbyadbutlercom clickclickmacroplaceholder if7
clickclickmacroplaceholder if windowadbutlerfunctionvar7
tibco software utkar4
nstan i ml4
software utkar till3
och peab bygger3
nytt i kllered3
peab bygger nytt3
till 2700 kvm3
park och peab3
utkar till 27003
nytt hk se3
2700 kvm hos3
kvm hos wallenstam3
jm tilltrder byggrtt3
tilltrder byggrtt fr3
byggrtt fr nytt3
fr nytt hk3
hk se nya3
dahlgrens gr bytesaffr3
victoria park och3
fr 841 miljoner3
och dahlgrens gr3
storflytt kan lmna3
50 mktigaste 20203
ml med affren3
med affren fr3
affren fr 8413
redo fr ny3
fr ny storflytt3
ny storflytt kan3
kan lmna hagastaden3
skebo och dahlgrens3
smll fr steen3
fr steen strm3
steen strm nr3
strm nr hlns3
nr hlns stnger3
hlns stnger nnu3
stnger nnu mer3
se nya bilder3
if windowadbutlerfunctionvar13
adbutlerads var13
windowadbutlerfunctionvar s13
servedbyadbutlercom clickclickmacroplaceholder13
domain servedbyadbutlercom13
abkw domain13
opt place13
opt opt13
functionopt adbutlerregister16508013
adbutleradspushhandler functionopt13
documentwrite adbutleradspushhandler13
0 documentwrite13
windowabkw var13
abkw windowabkw13
var abkw13
keywords abkw13
adbutlerads adbutlerads13
textjavascriptssrc httpsservedbyadbutlercomappjsvar13
s documentcreateelementscript13
adbutler adbutlerads13
documentcreateelementscript sasync13
true stype13
stype textjavascriptssrc13
sasync true13
httpsservedbyadbutlercomappjsvar n13
documentgetelementsbytagnamescript0 nparentnodeinsertbefores13
nparentnodeinsertbefores n13
n var13
n documentgetelementsbytagnamescript013
adbutler adbutler13
var adbutler13
clickclickmacroplaceholder if7
50 mktigaste6
tibco software4
software utkar4
utkar till3
park och3
bygger nytt3
peab bygger3
och peab3
2700 kvm3
victoria park3
till 27003
hk se3
kvm hos3
hos wallenstam3
jm tilltrder3
tilltrder byggrtt3
byggrtt fr3
fr nytt3
nytt hk3
se nya3
nya bilder3
dahlgrens gr3
gr bytesaffr3
841 miljoner3
och dahlgrens3
storflytt kan3
mktigaste 20203
logistea nstan3
ml med3
med affren3
affren fr3
fr 8413
redo fr3
fr ny3
ny storflytt3
kan lmna3
skebo och3
lmna hagastaden3
smll fr3
fr steen3
steen strm3
strm nr3
nr hlns3
hlns stnger3
stnger nnu3
nnu mer3
vad som3
var39
n27
abkw26
adbutlerads26
adbutler26
opt26
fr18
s15
if13
keywords13
place13
functionopt13
domain13
servedbyadbutlercom13
clickclickmacroplaceholder13
windowadbutlerfunctionvar13
adbutlerregister16508013
adbutleradspushhandler13
documentwrite13
sasync13
013
windowabkw13
nparentnodeinsertbefores13
documentgetelementsbytagnamescript013
httpsservedbyadbutlercomappjsvar13
textjavascriptssrc13
stype13
true13
documentcreateelementscript13
om12
och12
p12
av11
110
som9
med9
till9
nytt7
har7
kan7
26
fv6
36
mktigaste6
nstan5
se5
nya5
ett5
peab5
seminarier5
wallenstam5
skebo4
vad4
berttar4
nr4
hlns4
stnger4
mer4
vill4
tibco4
dahlgrens4
44
gr4
software4
det4
kllered4
victoria4
utkar4
ml4
nnu4
nu4
nyheter4
ut4
projekt4
fler4
r4
logga4
hk4
portrtt4
lmna4
bilder3
byggrtt3
jobb3
jm3
ytterligare3
fastighetsvrlden3
hos3
fastigheter3
kvm3
oss3
53
63
tilltrder3
bygger3
karrir3
miljoner3
hagastaden3
storflytt3
smll3
steen3
strm3
ny3
redo3
att3
under3
73
affren3
logistea3
bytesaffr3
frn3
park3
83
den3

Fastighetsvarlden.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Fasti.it
Fasti S.p.a. - Macchine per catene
Fastiaccess.com
HOME | Fast Indian Access Company
Fasticash.com
FASTICASH.COM - FAST CASH FOR YOUR INSURANCE POLICY
Fastick.com
.:.welcome to FASTICK website.:.
Fasticket.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Fasticon.com
🏆 Emoji Guide – 🔥 The Ultimate Emoji Guide: 🌈 Meanings, 🍎 Platforms, 🆘 Codes and 😍 More
Fastideas.com
Domain For Sale: fastideas.com
Fastidiousdesigns.com
Fastidious Designs

Recently Updated Websites

Valeurdusage.net 1 second ago.Fremdgehen18.com 2 seconds ago.Testscoreguide.org 3 seconds ago.Easy-shims.com 4 seconds ago.Tamagoyu.net 4 seconds ago.Obelisk-eg.com 5 seconds ago.Rarehealth.net 6 seconds ago.Nnnadvisor.info 6 seconds ago.Yottapreneur.com 6 seconds ago.Kamagratabletten.com 6 seconds ago.Lead-freebushings.com 7 seconds ago.Callicoonbrewing.com 7 seconds ago.Gzlsl.com 7 seconds ago.Chenshanyufz.com 8 seconds ago.Josepacajoj.com 8 seconds ago.Jessieflower.com 8 seconds ago.Gerda-mueller.at 8 seconds ago.1r39.com 9 seconds ago.International-dir.com 10 seconds ago.Leaveuania.org 11 seconds ago.Nashvillecommunitydarkroom.org 11 seconds ago.Ewaste4good.com 11 seconds ago.Seanraspet.org 11 seconds ago.Freedomrespiratory.com 13 seconds ago.Moda-mondo.myshopify.com 13 seconds ago.Designbycherice.com 13 seconds ago.Mppldev.org 13 seconds ago.Mathsolution.net 13 seconds ago.Cappuccine.net 13 seconds ago.Oncoguia.org.br 14 seconds ago.