Fawheels.co.uk Favicon Fawheels.co.uk

Fawheels.co.uk Website Thumbnail
Checking...
Alloy Wheel Refurbishment & Repair in London from First Aid Wheels
Low trust score
Add a review Change category Claim this site
For the best alloy wheel refurbishment work in London, contact us today. First Aid Wheels are experts in alloy wheel repair and wheel refurbishment.


Domain summary

Domain label
fawheels
Domain extension
co.uk
Domain registered:
06-Jun-2009
Domain updated:
30-May-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is fawheels.co.uk ranked relative to other sites:

Percentage of visits to fawheels.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Fawheels.co.uk registered?
A: Fawheels.co.uk was registered 11 years, 4 months, 2 weeks, 3 days, 21 hours, 49 minutes, 57 seconds ago on Saturday, June 6, 2009.
Q: When was the WHOIS for Fawheels.co.uk last updated?
A: The WHOIS entry was last updated 4 months, 3 weeks, 3 days, 21 hours, 49 minutes, 57 seconds ago on Saturday, May 30, 2020.
Q: What are Fawheels.co.uk's nameservers?
A: DNS for Fawheels.co.uk is provided by the following nameservers:
  • fay.ns.cloudflare.com
  • lee.ns.cloudflare.com
Q: Who is the registrar for the Fawheels.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Fawheels.co.uk?
A: Fawheels.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Fawheels.co.uk each day?
A: Fawheels.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Fawheels.co.uk resolve to?
A: Fawheels.co.uk resolves to the IPv4 address 104.24.103.57.
Q: In what country are Fawheels.co.uk servers located in?
A: Fawheels.co.uk has servers located in the United States.
Q: What webserver software does Fawheels.co.uk use?
A: Fawheels.co.uk is powered by CloudFlare webserver.
Q: Who hosts Fawheels.co.uk?
A: Fawheels.co.uk is hosted by CloudFlare, Inc. in United States.
Q: How much is Fawheels.co.uk worth?
A: Fawheels.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Fawheels.co.uk?

Fawheels.co.uk Hosting Provider Information

Hosted IP Address:104.24.103.57
Hosted Hostname:104.24.103.57
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Fawheels.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 19 Oct 2020 17:01:02 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Location: https://www.fawheels.co.uk/
CF-Cache-Status: DYNAMIC
cf-request-id: 05e367baf70000dbe703bf6000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?lkg-colo=21&lkg-time=1603126863"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5e4c0f0b28bbdbe7-LHR

Fawheels.co.uk Domain Nameserver Information

HostIP AddressCountry
fay.ns.cloudflare.com 172.64.32.115
lee.ns.cloudflare.com 172.64.33.129


Need to find out who hosts Fawheels.co.uk?


WhoIs information for Fawheels.co.uk

 Domain name:
fawheels.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk

Relevant dates:
Registered on: 06-Jun-2009
Expiry date: 06-Jun-2021
Last updated: 30-May-2020

Registration status:
Registered until expiry date.

Name servers:
fay.ns.cloudflare.com
lee.ns.cloudflare.com

WHOIS lookup made at 17:04:17 23-Aug-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Fawheels.co.uk Free SEO Report

Website Inpage Analysis for Fawheels.co.uk

H1 Headings

1 :
  1. First Aid Wheels provides expert alloy wheel repair and refurbishment in London

H2 Headings

7 :
  1. Collection and Delivery Service
  2. Diamond Cut Wheels Refurbishment
  3. Powder Coating
  4. Alloy Wheel Straightening
  5. Alloy Wheel Welding
  6. Alloy Wheel Exchange
  7. Tyres

H3 Headings

7 :
  1. Lamborghini Wheels Experts
  2. We offer a comprehensive range of wheel refurbishment services
  3. Tesla Wheels Specialist
  4. Opening hours
  5. Account
  6. Links
  7. Address

H4 Headings

2 :
  1.    First Aid Wheels Alloy wheel repair, refurbishment & customisation specialists in London  
  2. FAW Customs - Powered by First Aid Wheels

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

8 :

Google Adsense

:
pub-6051373713203570

Google Analytics

:
UA-18663666-1

Links - Internal

74:
  1. privacy policy
    http://fawheels.co.uk/legal/privacy-policy
  2. Read here
    http://fawheels.co.uk/page/keeping-your-car-running-keeping-us-all-safe-during-covid19
  3. [email protected]
    http://fawheels.co.uk/cdn-cgi/l/email-protection#731a1d151c331512041b16161f005d101c5d0618
  4. Login
    http://fawheels.co.uk/web/login
  5. Wishlist
    http://fawheels.co.uk/shop/product/whishlists
  6. No text
    http://fawheels.co.uk/
  7. Our Story
    http://fawheels.co.uk/about-us
  8. Warranties
    http://fawheels.co.uk/warranties
  9. Terms and Conditions
    http://fawheels.co.uk/terms-and-conditions
  10. About The Finish
    http://fawheels.co.uk/services/Alloy-Wheel-Powder-Coating
  11. Our Process
    http://fawheels.co.uk/process/powder-coating
  12. About The Finish
    http://fawheels.co.uk/services/Diamond-Cut-Alloy-Refurbishment
  13. Our Process
    http://fawheels.co.uk/process/diamond-cutting
  14. About The Finish
    http://fawheels.co.uk/services/Alloy-Wheel-Polishing
  15. Our Process
    http://fawheels.co.uk/process/ceramic-ball-polishing
  16. Custom & Bespoke Finishes
    http://fawheels.co.uk/services/custom-bespoke-finishes
  17. Split Rims Refurbishment
    http://fawheels.co.uk/services/split-rims-refurbishment
  18. End of lease refurbishment
    http://fawheels.co.uk/services/end-of-lease-wheel-refurbishment
  19. Motorbike Wheels Refurbishment
    http://fawheels.co.uk/services/motorbike-wheels-refurbishment
  20. Collection and Delivery Service
    https://www.fawheels.co.uk/page/collection-and-delivery-service
  21. Courtesy Wheels
    http://fawheels.co.uk/services/courtesy-wheels
  22. Limitations
    http://fawheels.co.uk/refurbishment-and-repair-limitations
  23. Straightening
    http://fawheels.co.uk/services/alloy-wheel-straightening
  24. Welding
    http://fawheels.co.uk/services/alloy-wheel-welding
  25. Smart Repairs
    http://fawheels.co.uk/services/smart-repairs
  26. How does that work?
    http://fawheels.co.uk/services/alloy-wheel-exchange
  27. Exchange Shop
    http://fawheels.co.uk/alloy-wheel-exchange-rules
  28. Brake Calipers Refurbishment
    http://fawheels.co.uk/services/brake-calipers-refurbishment
  29. Alloy Wheels Ceramic Coating
    http://fawheels.co.uk/services/alloy-wheel-ceramic-coating
  30. Parts Powder Coating
    http://fawheels.co.uk/services/parts-powder-coating
  31. TPMS Sensors Service
    http://fawheels.co.uk/services/tpms-sensors-service-replacement
  32. Tyres Service
    http://fawheels.co.uk/services/new-tyres-supply
  33. Trade Customers
    http://fawheels.co.uk/services/trade-customers
  34. Car Detailing & Protection
    https://www.fawheels.co.uk/services/car-detailing-paint-protection
  35. Sell / Trade-in your wheels
    http://fawheels.co.uk/services/sell-your-oem-wheels
  36. Gallery
    http://fawheels.co.uk/gallery
  37. Shop
    http://fawheels.co.uk/our-shop
  38. Pricing
    http://fawheels.co.uk/prices
  39. FAQ
    http://fawheels.co.uk/faq
  40. Book service
    https://www.fawheels.co.uk/page/book-an-appointment
  41. Get A Quote
    http://fawheels.co.uk/get-a-quote
  42. Contact
    http://fawheels.co.uk/contact
  43. My cart
    http://fawheels.co.uk/shop/cart
  44. Read More
    http://fawheels.co.uk/page/collection-and-delivery-service
  45. About The Finish
    http://fawheels.co.uk/Diamond-Cut-Alloy-Refurbishment
  46. Pricing
    http://fawheels.co.uk/prices#diamond
  47. About The Finish
    http://fawheels.co.uk/page/powder-coated-finish
  48. Pricing
    http://fawheels.co.uk/our-prices.html#powder
  49. Read More
    http://fawheels.co.uk/page/straightening
  50. Read More
    http://fawheels.co.uk/page/welding
  51. Read More
    http://fawheels.co.uk/how-does-it-work.html
  52. Read More
    http://fawheels.co.uk/new-tyres-supply.html
  53. Tyre Shop
    http://fawheels.co.uk/page/tyres-1
  54. Send An Email
    http://fawheels.co.uk/cdn-cgi/l/email-protection#84edeae2ebc4e2e5f3ece1e1e8f7aae7ebaaf1ef
  55. Your Account
    http://fawheels.co.uk/my/home
  56. Order History
    http://fawheels.co.uk/my/orders
  57. Update Your Details
    http://fawheels.co.uk/my/account
  58. Your Invoices and Payments
    http://fawheels.co.uk/my/invoices
  59. Your Quotes
    http://fawheels.co.uk/my/quotes
  60. Your Wishlist
    http://fawheels.co.uk/shop/product/whishlists
  61. Events
    http://fawheels.co.uk/event
  62. Livechat Support
    http://fawheels.co.uk/livechat/
  63. About Us
    http://fawheels.co.uk/page/about-us
  64. Frequently Asked Questions
    http://fawheels.co.uk/page/faq
  65. Terms & Conditions
    http://fawheels.co.uk/page/t-cs-1
  66. No text
    http://fawheels.co.uk/page/t-cs-1
  67. Warranties
    http://fawheels.co.uk/page/warranties
  68. Contact Us
    http://fawheels.co.uk/page/contactus
  69. Our blog
    http://fawheels.co.uk/blog/our-blog-1
  70. No text
    http://fawheels.co.uk/blog/1
  71. [email protected]
    http://fawheels.co.uk/cdn-cgi/l/email-protection
  72. Terms of use
    http://fawheels.co.uk/legal/terms-of-use
  73. Privacy Policy
    http://fawheels.co.uk/legal/privacy-policy
  74. Legal Advice
    http://fawheels.co.uk/legal/advice

Links - Internal (nofollow)

0:

Links - Outbound

12:
  1. Book An Appointment
    https://firstaidwheels.setmore.com/resourcebookingpage/r191eb7ff6be93e026c30b32ca0d676d06fb3f140
  2. No text
    https://www.facebook.com/pg/firstaidwheels/reviews
  3. No text
    https://www.google.com/search?q=First+Aid+Wheels+%26+Woodstock+Motors,+West+Heath+Yard,+174+Mill+Ln,+London+NW6+1TB,+UK&ludocid=8756014622096960966#lrd=0x4876107eb2f4510b:0x79839ce84e372dc6,1,,
  4. WhatsApp
    https://api.whatsapp.com/send?phone=447912760163
  5. Visit website
    https://www.fawcustoms.co.uk
  6. No text
    https://www.reviews.co.uk//company-reviews/store/fawheels-co-uk1
  7. No text
    https://en-gb.facebook.com/firstaidwheels/
  8. No text
    https://twitter.com/firstaidwheels
  9. No text
    https://www.youtube.com/channel/UCI-rDXQhupolb57tfknP4Zw
  10. free website
    http://www.odoo.com/page/website-builder
  11. Odoo
    http://www.odoo.com/page/website-builder
  12. No text
    https://my.setmore.com/bookingpage/bbf96512-9846-4470-bffc-0d5821716700

Links - Outbound (nofollow)

0:

Keyword Cloud for Fawheels.co.uk

serviceurl httpswwwfawheelscouk telephoneourlane west heathhttpswwwfawheelscoukwebimage49175nameclosesfinish ourwhichidexchangehavenbsp nbspexperts image httpswwwfawheelscoukwebimage49175first aidnbspgetreadlookustypequality6pmfactory174 millminutes theyrefurbishment experts imageid url httpswwwfawheelscoukhttpschemaorg typeminutes they hadtoppricerange context httpschemaorgcollectionhttpswwwfawheelscouk telephonedayofweekwe cancontext httpschemaorgrepair and refurbishmentlane west10 minutesweimage httpswwwfawheelscoukwebimage49175alloy wheel repairservicesamongpricerange contextwheelwe offerwheels alloy wheelread moreheath yardrepairsalloyyour vehiclewestimagehttpswwwfawheelscouk telephone 442074350941refurbishment expertsyardbookyour alloys174 mill lanepowder coatingwheelslondonaidsafetybook an appointment09417435 0941firstyour wheelshttpswwwfawheelscoukwebimage49175 id urlurl httpswwwfawheelscoukoffer2yourrefurbishedpowderhttpswwwfawheelscouk telephone 02074350941our processaid wheels alloyheaththey hadtermstyressuchcontextalloysmill laneifsetstraighteningnbsp nbsp 830amdeliveryexperts0repairtelephone 442074350941 pricerangeaid wheels3finish our processwest heathtelephonegbhttpswwwfawheelscoukcarrefurbishment830am 6pmprocessyou02074350941alloy wheelwhetherthemnbsp nbsp nbspdelivery serviceafternbsp 830am 6pmfinishweldingname firstcoatingnbsp 830amcontact1mill lane westceramicshopcontext httpschemaorg typelanefunctionwest heath yardcollection and deliverydiamondopensmillmorepricerangealloy wheelsminuteswheel refurbishmentcanid url10 minutes theytelephone 442074350941type openinghoursspecificationhad442074350941 pricerangeopeninghoursspecification dayofweeksoprotectionname first aidvehicletheywheel repair02074350941 pricerangemy830amtelephone 02074350941 pricerangetype openinghoursspecification dayofweekimage httpswwwfawheelscoukwebimage49175 idwebsitehttpschemaorgampurlsomecontactpointwheels alloyexperts imagetelephone 02074350941appointmentallhttpswwwfawheelscoukwebimage49175 idfirst aid wheelsaddressyour carpricingopeninghoursspecification

Longtail Keyword Density for Fawheels.co.uk

KeywordsOccurences
nbsp nbsp nbsp24
first aid wheels19
alloy wheel repair13
repair and refurbishment12
aid wheels alloy10
wheels alloy wheel10
context httpschemaorg type9
name first aid9
id url httpswwwfawheelscouk7
refurbishment experts image6
url httpswwwfawheelscouk telephone6
experts image httpswwwfawheelscoukwebimage491756
image httpswwwfawheelscoukwebimage49175 id6
httpswwwfawheelscoukwebimage49175 id url6
finish our process5
telephone 442074350941 pricerange4
pricerange context httpschemaorg4
nbsp 830am 6pm3
type openinghoursspecification dayofweek3
nbsp nbsp 830am3
telephone 02074350941 pricerange3
httpswwwfawheelscouk telephone 020743509413
lane west heath3
west heath yard3
collection and delivery3
mill lane west3
174 mill lane3
minutes they had3
10 minutes they3
book an appointment3
httpswwwfawheelscouk telephone 4420743509413
nbsp nbsp35
first aid20
alloy wheel20
aid wheels20
wheel repair15
wheels alloy10
refurbishment experts9
url httpswwwfawheelscouk9
httpschemaorg type9
context httpschemaorg9
name first9
id url7
httpswwwfawheelscouk telephone6
we offer6
httpswwwfawheelscoukwebimage49175 id6
image httpswwwfawheelscoukwebimage491756
experts image6
alloy wheels5
our process5
read more5
finish our5
pricerange context4
telephone 4420743509414
442074350941 pricerange4
your car4
7435 09414
your alloys4
powder coating4
wheel refurbishment4
mill lane3
02074350941 pricerange3
type openinghoursspecification3
minutes they3
delivery service3
830am 6pm3
nbsp 830am3
your wheels3
telephone 020743509413
lane west3
your vehicle3
they had3
174 mill3
we can3
10 minutes3
heath yard3
west heath3
openinghoursspecification dayofweek3
nbsp52
wheels43
wheel29
your27
alloy25
refurbishment24
we22
aid21
first21
repair18
type17
service14
our13
you13
experts12
london10
httpschemaorg9
name9
url9
httpswwwfawheelscouk9
finish9
telephone9
context9
alloys8
pricerange7
offer7
read7
id7
they6
image6
can6
us6
coating6
car6
more6
httpswwwfawheelscoukwebimage491756
safety5
shop5
exchange5
welding5
amp5
website5
powder5
process5
set5
have5
openinghoursspecification4
04
west4
minutes4
6pm4
them4
gb4
ceramic4
whether4
straightening4
my4
book4
09414
14
vehicle4
get4
diamond4
830am3
contactpoint3
lane3
heath3
opens3
yard3
dayofweek3
pricing3
delivery3
repairs3
protection3
tyres3
mill3
function3
020743509413
services3
if3
23
refurbished3
so3
which3
among3
some3
quality3
appointment3
collection3
factory3
top3
address3
such3
after3
33
had3
all3
terms3
contact3
look3
closes3

Fawheels.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Fawheels.co.uk is a scam?

Websites with Similar Names

Fawheels.co.uk
Alloy Wheel Refurbishment & Repair in London from First Aid Wheels

Recently Updated Websites

Chathamtides.com 1 second ago.Greenfamily.website 4 seconds ago.Xfun-rauris.com 4 seconds ago.Tuscany-tour-time.com 4 seconds ago.Dguadalajara.es 4 seconds ago.Sportovnirybari.cz 5 seconds ago.Quadrahosting.com.au 5 seconds ago.Smartcanadainvest.com 6 seconds ago.Liger.com.mx 6 seconds ago.Oliviatours.com 7 seconds ago.Mundharmonikalernen.com 7 seconds ago.Dispersium.es 7 seconds ago.Pohio.com 8 seconds ago.Empathic.com 8 seconds ago.Deovolenti.com 8 seconds ago.Maralex-kids.com 8 seconds ago.Plus.hr 8 seconds ago.Elsaadultcare.com 9 seconds ago.Atgcrm.com 9 seconds ago.Pabloavion.com 9 seconds ago.Oldfortsupply.com 9 seconds ago.Happymangos.com 9 seconds ago.Lefebvrepe.com 9 seconds ago.Archieglobal.com 10 seconds ago.Rhstuff.com 10 seconds ago.Druckerei-wien.at 11 seconds ago.Movie4k-hd.com 13 seconds ago.Projectartfornature.org 13 seconds ago.Carconnectivity.org 13 seconds ago.Sextoysperu.com 13 seconds ago.