Dansk design til alle hjem | Møbler, tilbehør og lamper - ferm LIVING

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-17
Category: This site has not been categorized yet

Med passion for autentisk og funktionelt dansk design laver vi møbler og interiør, der skaber rum til at være den du er. Fri levering over 650DKK


Domain summary

Domain label
fermliving
Domain extension
dk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is fermliving.dk ranked relative to other sites:

Percentage of visits to fermliving.dk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Fermliving.dk registered?
A: Fermliving.dk was registered 3 months, 1 week, 4 hours, 58 minutes, 11 seconds ago on Saturday, October 17, 2020.
Q: When was the WHOIS for Fermliving.dk last updated?
A: The WHOIS entry was last updated 3 months, 1 week, 4 hours, 58 minutes, 11 seconds ago on Saturday, October 17, 2020.
Q: What are Fermliving.dk's nameservers?
A: DNS for Fermliving.dk is provided by the following nameservers:
  • ns1.rrpproxy.net
  • ns2.rrpproxy.net
  • ns3.rrpproxy.net
  • anycast1.dnsres.net
  • anycast2.dnsres.net
Q: Who is the registrar for the Fermliving.dk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Fermliving.dk?
A: Fermliving.dk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Fermliving.dk each day?
A: Fermliving.dk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Fermliving.dk resolve to?
A: Fermliving.dk resolves to the IPv4 address 23.227.38.32.
Q: In what country are Fermliving.dk servers located in?
A: Fermliving.dk has servers located in the Canada.
Q: What webserver software does Fermliving.dk use?
A: Fermliving.dk is powered by CloudFlare webserver.
Q: Who hosts Fermliving.dk?
A: Fermliving.dk is hosted by Shopify, Inc. in Canada.
Q: How much is Fermliving.dk worth?
A: Fermliving.dk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Fermliving.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Fermliving.dk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Fermliving.dk

H1 Headings

1 :
  1. Komfort og Elegance

H2 Headings

9 :
  1. Multifunktionel Lysestage
  2. En Gave til Dig
  3. Nyheder
  4. The Home
  5. Shop dine Instagram favoritter
  6. Historier
  7. The Home of Juli Daoust Baker
  8. Copenhagen City Guide
  9. Designteamet

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-11801728-6

Links - Internal

31:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Fermliving.dk

elseright copyurlitem productdinvarenamereturnfunctionmigdktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault titleoption1default titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefaultbeskedwinboomrlvi beklager0produktarrow righttitleoption1default titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefault titleprice2500weight0compareatpricenullinventorymanagementnullbarcode72654400imagescdnshopifycomsfiles1015033106496products700001pngv1575565104featuredimagecdnshopifycomsfiles1015033106496products700001pngv1575565104optionstitlemediaaltnullid2834843926592position1previewimageaspectratio075height1920width1440srchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418aspectratio075height1920mediatypeimagesrchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418width1440contentifcopy 4 createdercopybreak casevenligstgiv mig beskedvifermp lagermedbeklagermig beskedtitleprice2500weight0compareatpricenullinventorymanagementnullbarcode72654400imagescdnshopifycomsfiles1015033106496products700001pngv1575565104featuredimagecdnshopifycomsfiles1015033106496products700001pngv1575565104optionstitlemediaaltnullid2834843926592position1previewimageaspectratio075height1920width1440srchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418aspectratio075height1920mediatypeimagesrchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418width1440contenttitleoption1default titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefaultproduct id4167498137664titlegaveindpakninghandlegiftwrappingsdescriptionpublishedat20190926t1253210200createdat20190926t1253390200vendorferm livinglevering2givfootericonboxcaseetkurvvarercreated with sketcharrow right copyhjemcopy 4voresdit hjemvalue formatwithdelimiterscentsvideregiv miggitemid4167498137664titlegaveindpakninghandlegiftwrappingsdescriptionpublishedat20190926t1253210200createdat20190926t1253390200vendorfermdencentstitleoption1defaulthomeproductdategettimekbfindproduct id4167498137664titlegaveindpakninghandlegiftwrappingsdescriptionpublishedat20190926t1253210200createdat20190926t1253390200vendorfermfootericonbox copytypeofdaid4167498137664titlegaveindpakninghandlegiftwrappingsdescriptionpublishedat20190926t1253210200createdat20190926t1253390200vendorferm living dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefaultogstorevlgrightdigordrelivingthousandsscriptlagerder4 created1dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault titleoption1defaultvalueditpressebreakformatwithdelimiterscentselse iftitleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefault titleprice2500weight0compareatpricenullinventorymanagementnullbarcode72654400imagescdnshopifycomsfiles1015033106496products700001pngv1575565104featuredimagecdnshopifycomsfiles1015033106496products700001pngv1575565104optionstitlemediaaltnullid2834843926592position1previewimageaspectratio075height1920width1440srchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418aspectratio075height1920mediatypeimagesrchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418width1440contentid4167498137664titlegaveindpakninghandlegiftwrappingsdescriptionpublishedat20190926t1253210200createdat20190926t1253390200vendorferm livingarrowvarnew dategettimecreatednewjegdktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefaulttildetdecimalhandelsbetingelsershoptrueitem product id4167498137664titlegaveindpakninghandlegiftwrappingsdescriptionpublishedat20190926t1253210200createdat20190926t1253390200vendorfermg tilferm livingduosliving dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault titleoption1defaultomformatinstagramkontaktright copy 4living dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefaultsketchtitleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefaultp

Longtail Keyword Density for Fermliving.dk

KeywordsOccurences
created with sketch13
copy 4 created9
right copy 47
arrow right copy7
item product id4167498137664titlegaveindpakninghandlegift-wrapping-sdescriptionpublishedat2019-09-26t1253210200createdat2019-09-26t1253390200vendorferm3
product id4167498137664titlegaveindpakninghandlegift-wrapping-sdescriptionpublishedat2019-09-26t1253210200createdat2019-09-26t1253390200vendorferm living3
id4167498137664titlegaveindpakninghandlegift-wrapping-sdescriptionpublishedat2019-09-26t1253210200createdat2019-09-26t1253390200vendorferm living dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault3
living dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault titleoption1default3
dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault titleoption1default titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefault3
titleoption1default titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefault titleprice2500weight0compareatpricenullinventorymanagementnullbarcode72654400imagescdnshopifycomsfiles1015033106496products700001pngv1575565104featuredimagecdnshopifycomsfiles1015033106496products700001pngv1575565104optionstitlemediaaltnullid2834843926592position1previewimageaspectratio075height1920width1440srchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418aspectratio075height1920mediatypeimagesrchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418width1440content3
giv mig besked3
4 created9
copy 49
right copy7
arrow right7
vi beklager4
value formatwithdelimiterscents4
ferm living4
g til4
new dategettime4
giv mig3
dit hjem3
mig besked3
else if3
p lager3
titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefault titleprice2500weight0compareatpricenullinventorymanagementnullbarcode72654400imagescdnshopifycomsfiles1015033106496products700001pngv1575565104featuredimagecdnshopifycomsfiles1015033106496products700001pngv1575565104optionstitlemediaaltnullid2834843926592position1previewimageaspectratio075height1920width1440srchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418aspectratio075height1920mediatypeimagesrchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418width1440content3
titleoption1default titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefault3
dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault titleoption1default3
living dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault3
id4167498137664titlegaveindpakninghandlegift-wrapping-sdescriptionpublishedat2019-09-26t1253210200createdat2019-09-26t1253390200vendorferm living3
product id4167498137664titlegaveindpakninghandlegift-wrapping-sdescriptionpublishedat2019-09-26t1253210200createdat2019-09-26t1253390200vendorferm3
item product3
break case3
footericonbox copy3
created13
if13
til13
sketch13
og12
med11
copy11
er10
p9
09
living9
18
new7
var7
right7
arrow7
vi7
dit7
name6
din6
venligst6
vores6
value6
dig6
function6
besked5
vlg5
g5
ferm5
der5
det5
else5
shop5
levering4
du4
24
case4
hjem4
formatwithdelimiterscents4
cents4
break4
true4
vare4
om4
dategettime4
kurv4
product4
beklager4
os4
footericonbox4
return4
home4
kb4
format3
script3
instagram3
den3
typeof3
url3
kontakt3
store3
find3
titleprice2500weight0compareatpricenullinventorymanagementnullbarcode72654400imagescdnshopifycomsfiles1015033106496products700001pngv1575565104featuredimagecdnshopifycomsfiles1015033106496products700001pngv1575565104optionstitlemediaaltnullid2834843926592position1previewimageaspectratio075height1920width1440srchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418aspectratio075height1920mediatypeimagesrchttpscdnshopifycomsfiles1015033106496products700001pngv1570102418width1440content3
thousands3
da3
titleoption1default3
dktypetagsprice2500pricemin2500pricemax2500availabletruepricevariesfalsecompareatpricenullcompareatpricemin0compareatpricemax0compareatpricevariesfalsevariantsid30301072654400titledefault3
id4167498137664titlegaveindpakninghandlegift-wrapping-sdescriptionpublishedat2019-09-26t1253210200createdat2019-09-26t1253390200vendorferm3
varer3
lager3
winboomrl3
item3
ordre3
handelsbetingelser3
videre3
jeg3
giv3
mig3
produkt3
titleoption2nulloption3nullsku70000requiresshippingtruetaxabletruefeaturedimagenullavailabletruenamegaveindpakningpublictitlenulloptionsdefault3
et3
decimal3
presse3

Who hosts Fermliving.dk?

Fermliving.dk Hosting Provider Information

Hosted IP Address:23.227.38.32
Hosted Hostname:23.227.38.32
Service Provider:Shopify, Inc.
Hosted Country:CanadaCA
Location Latitude:43.6319
Location Longitude:-79.3716
Webserver Software:CloudFlare

Is "Shopify, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Shopify, Inc.
0.6094%

HTTP Header Analysis for Fermliving.dk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 17 Oct 2020 10:17:57 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sorting-Hat-PodId: 63
X-Sorting-Hat-ShopId: 15033106496
X-Storefront-Renderer-Rendered: 1
Location: https://fermliving.dk/
X-Frame-Options: DENY
Content-Security-Policy: frame-ancestors 'none';
X-ShopId: 15033106496
X-ShardId: 63
Vary: Accept
X-Shopify-Stage: production
X-Dc: gcp-us-central1,gcp-us-central1,gcp-us-central1
X-Request-ID: ca723fc5-6746-4a5a-ab81-6de668f89360
X-Download-Options: noopen
X-Permitted-Cross-Domain-Policies: none
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
NEL: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
CF-Cache-Status: DYNAMIC
cf-request-id: 05d7a9f7d20000dc3bbd3cd000000001
Server: cloudflare
CF-RAY: 5e3945d2dd7bdc3b-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Fermliving.dk Domain Nameserver Information

HostIP AddressCountry
ns1.rrpproxy.net 94.23.167.207
ns2.rrpproxy.net 178.33.34.29
ns3.rrpproxy.net 144.217.35.17
anycast1.dnsres.net 162.88.60.9
anycast2.dnsres.net 162.88.61.9


Need to find out who hosts Fermliving.dk?


Domain Registration (WhoIs) information for Fermliving.dk

 # Hello 165.232.46.221. Your session has been logged.
#
# Copyright (c) 2002 - 2020 by DK Hostmaster A/S
#
# Version: 4.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: fermliving.dk
DNS: fermliving.dk
Registered: 2006-12-13
Expires: 2020-12-31
Registration period: 1 year
VID: no
DNSSEC: Unsigned delegation, no records
Status: Active

Nameservers
Hostname: anycast1.dnsres.net
Hostname: anycast2.dnsres.net
Hostname: ns1.rrpproxy.net
Hostname: ns2.rrpproxy.net
Hostname: ns3.rrpproxy.net

Websites with Similar Names

Fermliving.com
Danish design | Furniture, accessories and lamps - ferm LIVING
Fermliving.dk
Dansk design til alle hjem | Møbler, tilbehør og lamper - ferm LIVING
Fermlivingshop.com
Danish design | Furniture, accessories and lamps - ferm LIVING

Recently Updated Websites

Valex.hu (2 seconds ago.)Devils.ro (2 seconds ago.)Thekindappetite.com (4 seconds ago.)Trade-investments.com (6 seconds ago.)Dewelle.nl (6 seconds ago.)Geolaiv.ru (8 seconds ago.)Lexingtonstudenthousing.com (9 seconds ago.)Durags.com (9 seconds ago.)Forrest.online (11 seconds ago.)Psychketaminemt.com (12 seconds ago.)Whatisthis.co (14 seconds ago.)Plataoapucarana.com.br (19 seconds ago.)Xn--hu5b74o0ra.com (20 seconds ago.)Deltadentalmnshop.com (23 seconds ago.)Skyrise.co.za (24 seconds ago.)Esbilac.pro (25 seconds ago.)Ji.uk (26 seconds ago.)Osbornministrytraining.com (28 seconds ago.)Hertelavenue.com (30 seconds ago.)Homefragrance.ru (31 seconds ago.)Haling-associates.com (34 seconds ago.)Joelgomez.info (34 seconds ago.)Chinese-drywall-settlements.com (38 seconds ago.)Americanshrimp.com (40 seconds ago.)Nurie-world.com (40 seconds ago.)Turkpedia.com (41 seconds ago.)Westchasedistrictapartments.com (42 seconds ago.)Conciergerie-montagnes.com (42 seconds ago.)Aerialartsstudio253.com (44 seconds ago.)Mcdrive.ge (45 seconds ago.)

Recently Searched Keywords

��ˮ��ҵ����� (1 second ago.)lxrnod (2 seconds ago.)attivit (3 seconds ago.)di layartogel (4 seconds ago.)mth3 mth6 mth9 (5 seconds ago.)painel de hospedagem (6 seconds ago.)clixsense nasıl kullanılır videolu anlatım (7 seconds ago.)middle screen-xs (9 seconds ago.)read moredu lịch hải tiến bạn đã thưởng thức tôm tít hấp bia sả chưa (10 seconds ago.)stdte (10 seconds ago.)1 notes (11 seconds ago.)gamesys malta (12 seconds ago.)physics tutors (13 seconds ago.)font-weight 400 line-height (13 seconds ago.)fixed gear bike scene in china - 中国的fixed gear自行车 (17 seconds ago.)cunha (20 seconds ago.)clothing and equipment (20 seconds ago.)https: milk89.com wp-content uploads 2020 03 zamusolennaya-xu…-zreloj-mongolki[50]-scaled.jpg (20 seconds ago.)задержаны в admitad (21 seconds ago.)som inte (25 seconds ago.)amaphupho ngesonto (26 seconds ago.)15:04 爆乳 美女 自宅 セックス 松下紗栄子 (27 seconds ago.)dehiwala (27 seconds ago.)çanta demiri (29 seconds ago.)peribahasa melayu (31 seconds ago.)���߳����� (32 seconds ago.)serveurs dã©diã©s cloud (33 seconds ago.)highest (34 seconds ago.)serveur cloud infogã©rã© (36 seconds ago.)escaleras carpintería en kit (36 seconds ago.)