TV Movie Fernsehprogramm heute - TV Programm

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Das Fernsehprogramm von TV Movie bietet alle Infos zu Spielfilmen, Serien und Sendungen im TV Programm. Programmvorschau für über 150 Sender.



Domain summary

Last updated
2020-11-03
Domain label
fernsehwoche
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Fernsehwoche.de registered?
A: Fernsehwoche.de was registered 7 months, 2 weeks, 2 days, 13 hours, 1 minute, 58 seconds ago on Tuesday, November 3, 2020.
Q: When was the WHOIS for Fernsehwoche.de last updated?
A: The WHOIS entry was last updated 3 years, 1 month, 4 days, 13 hours, 1 minute, 58 seconds ago on Tuesday, May 15, 2018.
Q: What are Fernsehwoche.de's nameservers?
A: DNS for Fernsehwoche.de is provided by the following nameservers:
  • ns1a.dodns.net
  • ns2a.dodns.net
Q: Who is the registrar for the Fernsehwoche.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Fernsehwoche.de?
A: Fernsehwoche.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Fernsehwoche.de each day?
A: Fernsehwoche.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Fernsehwoche.de resolve to?
A: Fernsehwoche.de resolves to the IPv4 address 195.39.234.226.
Q: In what country are Fernsehwoche.de servers located in?
A: Fernsehwoche.de has servers located in the Germany.
Q: What webserver software does Fernsehwoche.de use?
A: Fernsehwoche.de is powered by CloudFlare webserver.
Q: Who hosts Fernsehwoche.de?
A: Fernsehwoche.de is hosted by Bauer Systems KG in Free And Hanseatic City Of Hamburg, Hamburg, Germany, 22305.
Q: How much is Fernsehwoche.de worth?
A: Fernsehwoche.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Fernsehwoche.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Fernsehwoche.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Fernsehwoche.de

H1 Headings

0 :

H2 Headings

5 :
  1. Jetzt im TV
  2. News
  3. TV Movie Fernsehprogramm
  4. Das komplette Fernsehprogramm – von ARD bis ZDF
  5. Vom Pro7-Spielfilm bis zur RTL-Krimiserie

H3 Headings

25 :
  1. Tagesschau
  2. Brisant
  3. heute
  4. hallo deutschland
  5. Die Superhändler - 4 Räume, 1 Deal
  6. Unter uns
  7. Die Gemeinschaftspraxis
  8. K11 - Die neuen Fälle
  9. taff
  10. Newstime
  11. RTLZWEI Wetter
  12. Krass Schule - Die jungen Lehrer
  13. Abenteuer Leben täglich
  14. Mein Lokal, Dein Lokal - Der Profi kommt
  15. Zwischen Tüll und Tränen
  16. First Dates - Ein Tisch für zwei
  17. Charmed - Zauberhafte Hexen
  18. Charmed - Zauberhafte Hexen
  19. Psych
  20. Dinner Date
  21. TV Programm
  22. TV Tipps
  23. Social & Aktionen
  24. TV Movie App
  25. Informationen

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-16104158-3

Links - Internal

69:

Links - Internal (nofollow)

0:

Links - Outbound

26:

Links - Outbound (nofollow)

0:

Keyword Cloud for Fernsehwoche.de

dermehr lesen fernsehennachheutezuonlineblackwiebissinddasdeutschlandddenstarsdocumentcreateelementscriptvon tv moviemagazinvarzumboulevardmagazin ddokusoap d 2020beitvmehrmehr lesenwetterfernsehprogramm vonzdfmoviediesenderistnewstv movieimwendlerblack fridaytvprogramm0aktuellelesen fernsehendesamrtllesenseitmichaeldocumentgetelementsbytagnamescript0serienmichael wendleruhr1fernsehenauchdas fernsehprogrammd 2020nachrichten d2mitfernsehprogrammsichuhr imtruealleoderuboulevardmagazin d 20203jetztdokusoapscsiearddokusoap dberim tvnachrichten d 2020boulevardmagazinvon tvvonseit 1700textjavascriptkrimiseriefridaynachrichten

Who hosts Fernsehwoche.de?

Fernsehwoche.de Hosting Provider Information

Hosted IP Address:195.39.234.226
Hosted Hostname:www.kochen-und-geniessen.net
Service Provider:Bauer Systems KG
Hosted Country:GermanyDE
Location Latitude:53.5867
Location Longitude:10.0473
Webserver Software:CloudFlare

Is "Bauer Systems KG" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Bauer Systems KG
0.0001%

HTTP Header Analysis for Fernsehwoche.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 03 Nov 2020 16:04:24 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Content-Type-Options: nosniff
Content-Language: de
X-Frame-Options: SAMEORIGIN
Last-Modified: Tue, 03 Nov 2020 16:01:56 0000
Cache-Control: public, s-maxage=300
Age: 147
CF-Cache-Status: DYNAMIC
cf-request-id: 06307343b300002c62f5a28000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 5ec754b2b8112c62-LHR
Content-Encoding: gzip

Fernsehwoche.de Domain Nameserver Information

HostIP AddressCountry
ns1a.dodns.net 185.61.8.110
ns2a.dodns.net 89.31.141.110


Need to find out who hosts Fernsehwoche.de?


Domain Registration (WhoIs) information for Fernsehwoche.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: fernsehwoche.de
Nserver: ns1a.dodns.net
Nserver: ns2a.dodns.net
Status: connect
Changed: 2018-05-15T18:39:01+02:00

Websites with Similar Names

Ferns-davco.com
ferns-davco.com -&nbspThis website is for sale! -&nbspferns davco Resources and Information.
Ferns-gully.online
ferns-gully.online is coming soon
Ferns.cn
THE A-ONE HOUSEWARE CO.,LIMITED
Ferns.education
Выбери лучший кредит онлайн на карту в Украине быстро и легко
Ferns.guitars
Fern's Guitars - home - handgemaakte lapsteel, Weissenborn en andere gitaren uit Amsterdam en reparatie werk
Ferns67.com
Index of /
Fernsabo.com
Spring Creative || Marketing and Design || Nelson BC
Fernsadventure.com
Squarespace - Website Expired

Recently Updated Websites

Product1876.com (1 second ago.)Bikinicammodels.com (2 seconds ago.)Dieneuschroeders.com (3 seconds ago.)Toptextil.pl (3 seconds ago.)Notjusthousekeeping.com (4 seconds ago.)Thelatinalternative.com (4 seconds ago.)Caligrama.com.mx (4 seconds ago.)Velckro.com (5 seconds ago.)Hikesai.com (5 seconds ago.)Keyworkers.space (5 seconds ago.)Mofidteb.com (6 seconds ago.)Daisybassen.info (6 seconds ago.)Cnws-alliance.com (6 seconds ago.)Oamsis.com (7 seconds ago.)Thepooool.com (7 seconds ago.)Insng.com (8 seconds ago.)Thetoolplugrentals.com (8 seconds ago.)Partzmall.com (9 seconds ago.)Beststayathomebiz.com (9 seconds ago.)Agerupgaard.dk (10 seconds ago.)Lawgiven.com (10 seconds ago.)Globeandarrows.com (11 seconds ago.)Sexringofdesire.com (11 seconds ago.)Livetype-a.com (12 seconds ago.)Eruditastana.com (12 seconds ago.)Coverpaw.com (13 seconds ago.)Sugimoto-tosou.com (13 seconds ago.)Hizeny.com (13 seconds ago.)Pinevalleyranch.org (13 seconds ago.)Patientsbeforeprofits.com (13 seconds ago.)

Recently Searched Keywords

stay (2 seconds ago.)gateway computers (4 seconds ago.)piano & keyboards (5 seconds ago.)importantz-index50 (6 seconds ago.)u20ac (7 seconds ago.)business colleges in california (11 seconds ago.)tcp analysis with wireshark (12 seconds ago.)spartan helmet (13 seconds ago.)click here for all the articles (16 seconds ago.)tricky old teacher (17 seconds ago.)blog contact (19 seconds ago.)appointment (21 seconds ago.)scale3d11 (22 seconds ago.)findoor (22 seconds ago.)herowrapper-slideshow hero--color-5 heropause (22 seconds ago.)producthandle (24 seconds ago.)see (25 seconds ago.)titleftitlefontsettingsftitlefontstyleftitlefonttransformftitlefontspacingftitlefcatfonttitlearticle (26 seconds ago.)tm vlxd (26 seconds ago.)netherlands (29 seconds ago.)coronavirus crisis (30 seconds ago.)tickets ticket (30 seconds ago.)kode (30 seconds ago.)báo giá tôn phương nam (34 seconds ago.)» life insurance (37 seconds ago.)letran calamba (39 seconds ago.)secara online (41 seconds ago.)鑄鐵彎板係列 (41 seconds ago.)vivial (44 seconds ago.)simon k (44 seconds ago.)