Fernuni-Hilfe.de | FernUni Hagen Forum & Community

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-26
Category: This site has not been categorized yet

FernUni Hagen Forum FernUniversität in Hagen Community Fernstudium Studienservice


Domain summary

Domain label
fernuni-hilfe
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is fernuni-hilfe.de ranked relative to other sites:

Percentage of visits to fernuni-hilfe.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Fernuni-hilfe.de registered?
A: Fernuni-hilfe.de was registered 4 months, 1 week, 5 days, 8 hours, 42 minutes, 3 seconds ago on Monday, October 26, 2020.
Q: When was the WHOIS for Fernuni-hilfe.de last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 1 day, 8 hours, 42 minutes, 3 seconds ago on Tuesday, September 8, 2020.
Q: What are Fernuni-hilfe.de's nameservers?
A: DNS for Fernuni-hilfe.de is provided by the following nameservers:
  • ns5.kasserver.com
  • ns6.kasserver.com
Q: Who is the registrar for the Fernuni-hilfe.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Fernuni-hilfe.de?
A: Fernuni-hilfe.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Fernuni-hilfe.de each day?
A: Fernuni-hilfe.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Fernuni-hilfe.de resolve to?
A: Fernuni-hilfe.de resolves to the IPv4 address 85.13.128.8.
Q: In what country are Fernuni-hilfe.de servers located in?
A: Fernuni-hilfe.de has servers located in the Germany.
Q: What webserver software does Fernuni-hilfe.de use?
A: Fernuni-hilfe.de is powered by Apache webserver.
Q: Who hosts Fernuni-hilfe.de?
A: Fernuni-hilfe.de is hosted by Neue Medien Muennich GmbH in Germany.
Q: How much is Fernuni-hilfe.de worth?
A: Fernuni-hilfe.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Fernuni-hilfe.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Fernuni-hilfe.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Fernuni-hilfe.de

H1 Headings

1 :
  1. Fernuni-Hilfe.de | FernUni Hagen Forum & Community

H2 Headings

6 :
  1. FernUniversität in Hagen Wirtschaft Recht Kultur- und Sozialwissenschaften Mathematik und Informatik
  2. FernUniversität in Hagen
  3. Wirtschaft
  4. Recht
  5. Kultur- und Sozialwissenschaften
  6. Mathematik und Informatik

H3 Headings

44 :
  1. Suche
  2. Studium an der FernUni Hagen
  3. Plauderecke FernUni Hagen
  4. Infos zu Fernuni-Hilfe.de
  5. Lernen und Organisation
  6. Hilfsmittel (Technik, Software, Zubehör etc.)
  7. LaTeX für schriftliche Fernuni-Arbeiten
  8. Lernvideos (alle Studiengänge)
  9. Tagebücher
  10. Finanzierung und Steuern
  11. Studieren mit Behinderung
  12. Newsfeed Beruf & Bildung
  13. FernUni vor Ort
  14. Zu Besuch in Hagen
  15. Marktplatz
  16. Bachelor Wirtschaftswissenschaft
  17. Bachelor Wirtschaftsinformatik
  18. Master Wirtschaftswissenschaft
  19. Master Volkswirtschaftslehre
  20. Master Wirtschaftsinformatik
  21. Master Wirtschaftswissenschaft (Ing. und Naturw.)
  22. Bachelor of Laws
  23. Master of Laws
  24. Erste Juristische Prüfung
  25. Bachelor Kulturwissenschaften
  26. Bachelor Politikw., Verwaltungsw., Soziologie
  27. Bachelor Bildungswissenschaft
  28. Bachelor Psychologie
  29. Master Bildung und Medien
  30. Master Europäische Moderne
  31. Master Geschichte Europas
  32. Master Governance
  33. Master Philosophie
  34. Master Psychologie
  35. Master Soziologie
  36. Bachelor Informatik
  37. Bachelor Wirtschaftsinformatik
  38. Bachelor Mathematik
  39. Master Informatik
  40. Master Praktische Informatik
  41. Master Wirtschaftsinformatik
  42. Master Mathematik
  43. Neueste Beiträge
  44. Teilen

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

56 :

Google Adsense

:
pub-5241885686911406

Google Analytics

:
UA-30864945-1

Links - Internal

895:

Links - Outbound (nofollow)

0:

Keyword Cloud for Fernuni-hilfe.de

1346bsc themenim internetprogrammable gatevirtuellewssteuerungquantitative bachelormodulevertiefung softwareheute um 0837grundlagen des marketingn sonstigesnbspwerdigitale31581 unternehmensgrndung31001 einfhrungexcel wahlpflicht vwlgestaltung kooperativer systemesbewertungstheorie uoptimierungsmethoden desder kryptografie 61412bankwirtschaftlichelinearefr sichere610837studienphaseoperationstrade and economicbankmanagement 31541 produktionsplanung33u softwaresystemenwahlpflichtmodulezivilprozessrechtoptimierung katalogpersonalfhrung 31711steuern und konomischebewertungstheorie u kreditrisikomfernunihilfede31011 externesmaster praktische informatik31511 finanzwirtschaft vertiefungwahlpflichtmodule betriebswirtschaft9geschichte32621 optimierungsmethoden2ps b vertiefunggrundlagen der kryptografiebwl ii 31031hagen plauderecke rechtswissenschaftrechnungswesen und funktbernatvertiefende konzepte voneinfhrung in dasfinanzierungunterforen rechtswissenschaftplaudereckemaster mathematikforumeuropasfachpraktikum fr sicherekooperativer systemeprogrammierenhagen plauderecke wirtschaftswissenschaftbachelorarrays fachpraktikumsteuerplanungindustriekonomikunternehmensrechtwirtschaftspolitik 3179160dienstleistungsmanagement kundenbeziehung 32831internes rechnungswesenjahresabschluss nach hgbfhrung 32691folgendenkonomie der umweltpolitikunternehmensbewertunggrundlagen der informatikobjects databasesinteraktive systemewissensreprsentationmaster europische modernefachpraktikum internetsicherheit fachpraktikum55praktische informatik31921 konzernrechnungslegung 31951produktionsplanungder informatikp3preisbildung auf unvollkommenen61115 mathematische grundlagenunternehmensbewertung 32591seminare und bachelorarbeitfunktheute umunternehmensgrndung 31611startseiteeuropa und diebetriebliche informationssystemestabilittspolitikfachpraktikumalgorithmischekoopresearch 32661 stabilittspolitiksimulation vonfragen281k unterforenmenschcomputerinteraktion16wirtschaftspolitik 3190132711 businessbankmanagement 31561 dienstleistungskonzeptionenmodellierung von32841 wirtschaftsprfung28um 102531661 organisationifrsstaatbankmanagement 31541bachelor wirtschaftsinformatikhilfeichumweltpolitiksozialwissenschaften campus masterimdes operationslogisches und funktionalesmarketing 32641um 1025 nooriquantitative mastermoduleprozessmodellierungswerkzeuge fachpraktikumerfahrungsberichtefinanzw bewertungstheorieist nichttheorien strategien instrumente31661 organisation theorie32661 stabilittspolitik 32681dlprozesse 32791research 32661evmdatenstrukturen und datenbankenbachelormodul 31511ich habeauchtransformation wahlpflichtmoduleentwurf und implem32601 strategischesrechtswissenschaftkomplexittstheoriemaster philosophiestrategien instrumentepflichtmodule wirtschaftswissenschaft32861 finanzmanagementrechnernetzearbeitsrechtfinanzmanagement mit excelintelligencemichu kreditrisikom 32841wirtschaftsprfungnlogischesbachelormodule45rechtswissenschaft campusdes marketing 31631wandelsind diedatenbanksysteme fachpraktikumgesellschaftkulturwissenschaftenfachpraktikum erweiterbaregrundstrukturenplanung theorieneinfhrung in menschcomputerinteraktionvkatalog m1wirwissensmanagementthemen 0 beitrge202021 ea40erweiterbare datenbanksysteme fachpraktikum32511 steuernder umweltpolitikwei63aberich diefachpraktikum simulation31741 konomiestabilittspolitik 32681 zeitreihenanalysedienstleistungsmanagement dlprozesseeineritgovernancemidadwirtschaftswissenschaft fernuni hagensicharraysunterforen wirtschaftswissenschaft fernunieconomic31561 dienstleistungskonzeptionencomputer und menschws 202021instrumentegraphenalgorithmensoftwarerechnernetzenb4master geschichte europasgewinnstrategischesder marktwirtschaft 31051dienstleistungskonzeptioneneinseiten ca31741 konomie der632531 preisbildungtheorie gestaltung wandelallgemeiner teildassgate32681 zeitreihenanalysethemenpreisbildungkonomische anreize32651 betrieblichevermgensermittlung 31701 personalfhrung43internationales managementbwlfinanzw bewertungstheorie uinternetanwendungensystememarkt und staat31041 theoriewirtschaftmarketing 31631 marktforschung53konzeptecampus masterprobleme der32651 betriebliche steuerplanung51fachpraktikum paralleldiesewirtschaftswissenschaft fernuni32861 finanzmanagement mitbelegt letztewarinstrumente 31681 grundldesseiteninternationalesmathematik und informatikhagenparallel computingaufdlprozesse1731501 finanzwirtschaft31771 informationsmanagement27ist32621 optimierungsmethoden desbeitrge32721 international tradeps cb3wahlpflichtdenmodellierung von informationssystemenseitgate arrays39semesterstrukturenproblemlsenbachelorarbeitallokationstheorieletztenalgorithmen der bioinformatikkreditrisikom 32841 wirtschaftsprfungwirtschaftspolitik 31901 ffentlichewirtschaftsmathe und statistikunterforen bachelormsckulturellemarktforschung und sektoraleseinfhrung wiwipersonalfhrungcampus wirtschaftswissenschaftwirtschaftsmathemsc themenhabefield31031 internesklausureinsichthat im42verwaltungadvanced parallelfachpraktikum theoretische informatikpctechnologieexternesinvestitionallokationstheorie usafety ampalgorithmen derintkonzerncontrolling 32601meinemaster europischewirtschaftswissenschaft seminarebesteuerung und betrnumerische mathematikgrundlegende algorithmenletztedienstleistungsmanagementartikel34mehrint privatrechtsimulation von diskretenim wstimeinformationsmanagementgestaltung wandelmodulsteuerpolitikdeduktions und inferenzsysteme31721 marktmoderne programmiertechnikenproblemews 202021 optimierungsmethodenfhrung 32691 dienstleistungsmanagement31631 marktforschungkultur und sozialwissenschaften32771 allokationstheoriegraphischen strukturenkulturphilosophiethemen 22kpflichtmodule masterii 31031allgemeine tippstheorie31691 steuerlicheps btheorie derprogrammiertechniken und methodenmoving objects databasesdsl281kpsdokumenten und wissensmanagementfinanzaktuelle eanbspws19programmiersysteme fachpraktikumsteuerpolitik 31691uderwrterunvollkommenen mrktenalgorithmeneuropische wirtschaftspolitikba themen32721 internationaldienstleistungskonzeptionen 31581 unternehmensgrndungzukunftsweisende fhrungsicherheit safetyfachpraktikum programmiersysteme fachpraktikum32791 dienstleistungsmanagement kundenbeziehungvertiefendeanreizemarktwirtschaft 31051der politikfachpraktikum parallel programming31681 grundlifrs 31921grundlagen wirtschaftsmathebeitrge 283kvertiefende konzeptekryptografie 61412 linearesonstigesnbspwer hatdatenbanksysteme31901 ffentliche ausgabenanreize 32531iiproduktionskonzernrechnungslegung32581 investitionstheorie ufernuni hagenzeitreihenanalyseimplem2331701 personalfhrung 31711m2 computersystemewissensbasiertedie wirtschaftswissenschaftprogrammableunterforen informatikallokationstheorie u intrechnungslegunginteraktivezu76campus bachelormiddlead24sonstigesnbspwer58n sonstigesnbspwer hat31311 itgovernanceb vertiefung softwarequantitativegeschichte europas 4fachpraktikum menschcomputerinteraktion fachpraktikumkonzernrechnungslegung 31951grundlagenaugustnoori heute ummastermodule 32511trademathematische grundlagenmastermodule 32521 finanzorganisationenklausurvorbereitung22des marketing31911 jahresabschlussbeitrge 281k plaudereckenbsphallowahlpflicht vwleuropische202021 informationsmanagement50dienstleistungsmanagement kundenbeziehung31frliteraturbesonderer teilkundenbeziehungdeduktionssoftware engineeringfunktionales programmierendiskreten produktions fachpraktikumobjects3626theoretische informatik fachpraktikum32grundlagen deskatalog m7 computerdatenbanken in rechnernetzenbioinformatikwirtschaftsinformatik0 beitrge15fachpraktikum frinternational tradedokumentencomputeruntersttzteszumverteilte systemesafetydlprozesse 32791 dienstleistungsmanagementengineering und psdatenbankenrisikomanagement75bwl i 31021verwaltungswinvestitionstheorieffentliches4 oktober 2020programmierungnooriplauderecke informatik campushagen plauderecketeilmoving objectserweiterbare datenbanksystemeberda32571 konomische theoriewirtschaftsprfung 32851 risikomanagement31831 knowledge managementeanbspws 20202131951 digitale transformation80besuchthemen 0steuerplanung 32671 zukunftsweisendekonzepte vonbetriebswirtschaft mastermodulem4engineering und programmiersder kryptografiegewinn und vermgensermittlungsysteme katalog202021 informationsmanagement belegtthemen 22k beitrgeeuropas 4ea ke 1sonstigesnbspwer hat im57des controllingfachpraktikum cscw fachpraktikumerweiterbareseminar7mdieabschlussarbeit wiwihat68fernuniversittmodellierung32581 investitionstheorieinformatik campus informatiksteuerliche gewinneanbspwsimplem von informationssystemenplanungnichtder politik 3262162betriebswirtschaftbestehe ich diekonzernrechnungslegung 31951 digitaleke31561 dienstleistungskonzeptionen 31581hausarbeit und falltraining31951 digitaleallewissensbasierte systeme31021 investition31681 grundl besteuerunggestaltung wandel 31671ifrs 31921 konzernrechnungslegungorganisationplauderecke rechtswissenschaft52neueplauderecke informatikkooperativeronlineabbscthemen 14probleme der wirtschaftspolitikinternetmathematischegrundlegende algorithmen derkannbeiinternesfinanzwirtschaft vertiefungplauderecke wirtschaftswissenschaftkitheoretischemaster geschichteseptember 2020fr die32691 dienstleistungsmanagementbetriebliche steuerplanungvorwirtschaftswissenschaft 31011 externeskatalog m3 informationssysteme72privatrecht und zivilprozessrecht29datenbanksystemenoptimierungsmethodenarbeitenfebruar32671 zukunftsweisende fhrung7131101 grundlagen wirtschaftsmathehgbseptemberma themenplauderecke wirtschaftswissenschaft ampkatalog m2mediencomputingmathematikplaudereckenbsphallooktoberstudium an der41wirtschaftswissenschaft ampbetrexternes rechnungswesen8internationales management 32651kommunikations und rechnernetzebetr steuerpolitikkatalogempirische2020 chihfengbrianvon diskreten produktionseinemmarketing 31661 organisationmirtheorien strategien78der moderneffentlichewiwi erfahrungsberichte281k plaudereckenbsphalloprivate lerngruppen hausarbeitprivatstudiumstabilittspolitik 3268131901 ffentliche31011 externes rechnungsweseneinfhrung in die4besteuerungallgemeinerparallel programmingexcel36kdasinformationssystemen 31771 informationsmanagementdmasicherheitentscheidungsmethoden in uverwaltungsrechtm1 grundlagenkatalog m431831 knowledgepolitischeprogrammiersystemesoftwaresystemen32571 konomischestatistikcampus informatik seminareinvestition und finanzierungfinanzwinternetanwendungen fachpraktikumrhetorikfachpraktikum prozessmodellierungswerkzeuge fachpraktikumckommunikations283k64programmable gate arraysba32831 finanzw bewertungstheoriediskretenknowledge managementliebesecurityeconomic developmentder fernuni hagenejpstudierende der fernuniwettbewerbsrechtabschlussarbeitder bioinformatik79fachpraktikum prozessmodellierungswerkzeugekonometrieschwerpunktbereich ejpmoving48arbeitmaster bildungimplem vonunterforen wirtschaftswissenschaft31671 planung theorienaktuelle55105 arbeitsvertragsrechteuropas 4 oktoberbetriebswirtschaft mastermodule 3252112um 1017m3 informationssystemeeineauf dieteilenii 31031 internesinvestitionstheorie u unternehmensbewertungpolitik 32621es282kplaudereckenbsphallo an matransformationlerngruppen hausarbeitfalsechains14 beitrgegrundl7731781 probleme derrechtkonzepte von datenbanksystemenrechnungswesenkapitalmarktforschunggestern umauf unvollkommenen mrktenhat im wskatalog m4 softwareseminaresteuernkonzerncontrolling 32601 strategischesseminare ampprogrammiertechnikenu kreditrisikom49zukunftsweisende61115 mathematischemaster praktischevertiefung datenstruktureninternationales marketingcampussuchebekommenweltpraktischeresearch belegtmakrokonomikvwl und quantitativecommunitybusiness intelligencemaschinen25unterforen masternach hgbamp securitybetrieblicheausgabenwirtschaftswissenschaft 31011orthat sichm4 softwaresektoralesformelnsie31051 makrokonomikprozessmodellierungswerkzeugenoori heute21strategien1025 noorimultimedia und internetanwendungenwahlpflichtmodule betriebswirtschaft mastermodulebankwirtschaftliche modelledatabasesdes operations research5operations researchmanresearch belegt heutemasterarbeitinformationssystemen 31771supply chains 32861wissenschaftlichemenschcomputerinteraktion fachpraktikumstudiengangoptimierung katalog m2optimierungsmethoden des operationsproduktions fachpraktikummanagement 32651 betrieblichestrafrechtabschlussarbeit informatikgestaltungzivilrechtschriftlichedevelopmentduvermgensermittlung 31701hagen themen31611 innovationscontrolling 31621hgb und ifrs81computeruntersttztes koopdsl engineeringb vertiefungvon diskretenhistorischeseminare und masterarbeitffentliches rechtwandel 31671wirtschaftspolitiknur74pflichtmodulekreditrisikomsozialwissenschaften campus bachelorchains 32861 finanzmanagementwirtschaftspolitik 31791 industriekonomikorganisationen 31911klausurenfalltrainingorganisation theorieplanung theorien strategienmenscheuchsektorales marketing 31661b2finanzintermediation und bankmanagement31921 konzernrechnungslegungfachpraktikum menschcomputerinteraktionu int finanzwissenschauf unvollkommenenschuldrechtfernuniamp informatik22k beitrgeforenm1angewandte32711 business intelligencecomputersystemevertiefung 31521marketing 31661iiiengineeringinnovationscontrolling 31621 grundlagenfachpraktikum field programmablemarketing 32641 internationalesinformationssystemencaalsrisikomanagement in supplydiskussionfinanzwirtschaft vertiefung 3152132641 internationales managementfinanzmanagement mit32521 finanzseminare amp abschlussarbeitdichmchtencomputerjahresabschluss32791 dienstleistungsmanagementbetriebswirtschaft bachelormodul 31511lawbachelormodulinformationsmanagement belegtamp abschlussarbeit wiwima geschichte europas32851 risikomanagement32k beitrge30blernenmit excel wahlpflichtkonomische31581 unternehmensgrndung 3161173bewertungstheorieder wissensreprsentationinsolvenzrechtstrategisches und internationalesumarbeitsrecht iiproblemlsen in graphischenkatalog m7kundenbeziehung 32831 finanzwgovernancemodulewahlpflichtmodule betriebswirtschaft bachelormodulmaster soziologieamp abschlussarbeitbetriebssysteme22kbildungimmerdatenstrukturengrundl besteuerunggrundlagen der32731 angewandte konometriefachpraktikum internetsicherheitwiesteuerpolitik 31691 steuerlicheinformatik fachpraktikum2020 chihfengbrian masterklausurvwlkonomische theoriebachelor mathematikwirtschaftsprfung 32851theoretische informatikfinanz und bankwirtschaftliche32731 angewandte69finanzmanagementpreisbildung auffachpraktikum multimediagraphischenschwerpunktbereichfinanzierung bwl iidiskussion seminare202021 optimierungsmethoden desdie welt281k unterforen mastersteuerplanung 32671cscwinformationssystemeteil des32661 stabilittspolitiksteuerberaterprfunggmodellenochorganisationen 31911 jahresabschlusskultur32841 wirtschaftsprfung 32851programmierspolitikvirtuelle maschinenrechnungswesen bwlbeitrge 281k unterforen31911 jahresabschluss nach32561 entwurfkonomische anreize 32531finanzwirtschaftunternehmensbewertung 32591 konzerncontrollingbankmanagementkoop arbeiten31511 finanzwirtschaftvmarbeiten und lernenprogramminggrundlegendepsychologie4 oktoberoktober 2020 chihfengbrian32771 allokationstheorie uinformationssysteme und ki1025 noori masterfinanzwissenschvon informationssystemen 31771bestehe ichkatalog m1 grundlageneuropaerfahrungen mit31101 grundlagen0multimediaknowledgevonunvollkommenenb aktuellema geschichteinferenzsystemeexcel wahlpflichtbusinessnoori masteralgorithmische geometrieliterarischelineare optimierung katalogkreditrisikom 32841sozialeplauderecke rechtswissenschaft campusthemen 14 beitrgekatalog m2 computersystemedemwebseitesimulationcscw fachpraktikumadvancedentwurfjahresabschluss nach32591 konzerncontrollinglesenmultimediainformationssystemekonomie derkeinebachelormodul 31511 finanzwirtschaftdurchsuchender marktwirtschaftbildungswissenschaftabschlussarbeit wiwi diskussiontheorie gestaltungcampus wirtschaftswissenschaft seminareemcampus informatikwahlpflichtmodule informatiklerngruppenfernuniversitt in hagenexternes rechnungswesen bwlsozialwissenschaften campusws 202021 informationsmanagementder fernunibetriebswirtschaft bachelormodulwie bestehewie bestehe ichafdigitale transformation wahlpflichtmodule55110 intperspektiven31621 grundlagen desinternetsicherheitverteilteeinfhrungffentliche ausgabennachtheorie der politikseminare und abschlussarbeit31691 steuerliche gewinnorganisation theorie gestaltung14fachpraktikum simulation vonmoderneamp informatik campuskonzerncontrollingnumerischewiwi diskussion seminareu unternehmensbewertung 32591private lerngruppenmarktwirtschaftmarktforschunggeometriefield programmabledie wirtschaftsinformatikstudierendeinformationsvisualisierung imadvanced parallel computingeinfhrung in denunterforenzurfhrungfachpraktikum cscwbesteheresearchke 1beitrge 0grundstrukturen dermithabenregieren47erfahrungen61412 lineare optimierungm3methoden der32531 preisbildung aufps a vertiefung31521 finanzintermediationb aktuelle eanbspws3unibibliothekrechtswissenschaft fernuniversittmastermodule 32511 steuern32kvermgensermittlungmastermodule 32521dienstleistungskonzeptionen 31581chihfengbrianinformationsvisualisierungjulikundenbeziehung 3283118field programmable gatewieder31791 industriekonomik31851 europische wirtschaftspolitikgehtgate arrays fachpraktikum32591 konzerncontrolling 32601safety amp securitymarketing 31631der wirtschaftspolitik 31791marktwirtschaft 31051 makrokonomikverhalten in organisationenwirtschaftswissenschaft amp informatikletzte noori heuteoktober 2020ivvertiefungmastermodulezukunftsweisende fhrung 326916631611 innovationscontrollingeuropische modernewiwi65ihrvon informationssystemenoptimierungneue beitrge35computeruntersttztes koop arbeitenmethoden der wissensreprsentationsupply chainsgibt esgeschichte europaszu besuchfinanzierung bwlwerdenerstinternationaltipps31711 verhaltenunternehmensgrndung 31611 innovationscontrolling31701 personalfhrungdatevbrowserzeitreihenanalyse und kapitalmarktforschungsicherheit safety amp56fachpraktikum erweiterbare datenbanksystemeheuteletzte nooriseitegestaltung kooperativer31041 theorie derbeitrge 282ksteuerlichetheorienwandel 31671 planungmit dersozialphilosophieum timedienstleistungsmanagement dlprozesse 32791lawsvor ortkatalog m3latexeffizienteim ws 202021digitale transformationinnovationscontrollingcontrollinginstrumente 31681parallelfernuni hagen plaudereckestrategien instrumente 31681heute um 1025belegteffiziente graphenalgorithmen202021 ea ke31751 modellierungeanbspws 202021 easoziologiebittem1 grundlagen deranreize 32531 preisbildungfinanzintermediationwahlmodule38diskreten produktionssupplym5mathematische grundlagen derinstrumente deskonomische theorie derwirtschaftsrechtbachelor bildungswissenschaftm2masterea ke31781 problemegerade32691 dienstleistungsmanagement dlprozesseangewandte konometrievon datenbanksystemenmethodendiskussion seminare ampoperations research belegtinformatik campus wirtschaftswissenschaft31751 modellierung vonwenn55110 int privatrechtplauderecke kultur32641 internationalesum 0837informatik katalogsektorales marketinginternationaleaktuelle eanbspws 202021gibt1037true31601 instrumenteinstrumente des controllingvieleint finanzwissenschfachpraktikum programmiersysteme61412 linearesindhausarbeit1m7funkt steuerungtheorie der marktwirtschaftprivatefachpraktikum fieldfunktionalesdamitinformationsvisualisierung im internetstudierende derinformatik seminareszeabetr steuerpolitik 316910 beitrge 0besonderer31541 produktionsplanungliteraturwissenschaftsointernetsicherheit fachpraktikum67privatrechtentscheidungsmethoden70bwl iisichereampprfunglernmaterialchihfengbrian mastermanagement 32651marktm4 software engineeringm7 computerbildung und medienkryptografie 61412vertiefung software engineeringmaster wirtschaftsinformatikinformatik campusinnovationscontrolling 31621verhalten31031 internes rechnungswesenhier31801 problemlsen59wiwi diskussionunternehmensgrndungphilosophiethemen 32k beitrgebetriebliche steuerplanung 32671mrktenbelegt heute um44u unternehmensbewertung32831 finanzw31851 europischemaster governancekryptografielineare optimierungvertiefung 31521 finanzintermediation31601 instrumente desabschlussarbeit wiwi erfahrungsberichtethemen 32kinternationales marketing 32641europische wirtschaftspolitik 31901bankmanagement 31561202021 optimierungsmethodenwirtschaftswissenschaft seminare ampoder31621 grundlagenbachelor kulturwissenschaftenchains 32861managementpolitik 32621 optimierungsmethodender wirtschaftspolitikwirtschaftswissenschafteinenmit excelkonomieoperations research 32661heute um 1017investitionstheorie usozialwissenschaftenallgemeinebeitrge 281kgestern31071 einfhrungunterforen rechtswissenschaft fernuniversittfernunihilfebelegt heute32671 zukunftsweisendeglobalisierungerfolgreich20marketing54fachpraktikum theoretischeinformatikarbeitsvertragsrechtu intpersonalfhrung 31711 verhaltenden studiengang1131671 planungbersetzerbau

Longtail Keyword Density for Fernuni-hilfe.de

KeywordsOccurences
einfhrung in die18
kultur- und sozialwissenschaften14
der fernuni hagen13
oktober 2020 chihfengbrian11
des operations research11
optimierungsmethoden des operations11
plaudereckenbsphallo an ma11
ma geschichte europas11
geschichte europas 411
europas 4 oktober11
4 oktober 202011
engineering und ps10
vertiefung software engineering9
im ws 2020219
sonstigesnbspwer hat im9
hat im ws9
n sonstigesnbspwer hat8
grundlagen des marketing8
fernuni hagen plauderecke8
seminare amp abschlussarbeit8
vwl und quantitative8
2020 chihfengbrian master7
31621 grundlagen des7
fernuniversitt in hagen7
seminare und masterarbeit7
31691 steuerliche gewinn-6
personalfhrung 31711 verhalten6
31701 personalfhrung 317116
vermgensermittlung 31701 personalfhrung6
gewinn- und vermgensermittlung6
31681 grundl besteuerung6
steuerpolitik 31691 steuerliche6
besteuerung und betr6
31911 jahresabschluss nach6
finanzintermediation und bankmanagement6
31611 innovationscontrolling 316216
innovationscontrolling 31621 grundlagen6
verhalten in organisationen6
betr steuerpolitik 316916
jahresabschluss nach hgb6
wirtschaftswissenschaft amp -informatik6
plauderecke wirtschaftswissenschaft amp6
belegt heute um6
amp abschlussarbeit wiwi6
sozialwissenschaften campus master6
31011 externes rechnungswesen6
ifrs 31921 konzernrechnungslegung6
hgb und ifrs6
organisationen 31911 jahresabschluss6
32621 optimierungsmethoden des6
instrumente 31681 grundl5
strategien instrumente 316815
organisation theorie gestaltung5
theorien strategien instrumente5
entscheidungsmethoden in u5
31741 konomie der5
problemlsen in graphischen5
31831 knowledge management5
31851 europische wirtschaftspolitik5
konomie der umweltpolitik5
31671 planung theorien5
wandel 31671 planung5
gestaltung wandel 316715
theorie gestaltung wandel5
planung theorien strategien5
marketing 31661 organisation5
31661 organisation theorie5
rechnungswesen und funkt5
bildung und medien5
hagen plauderecke wirtschaftswissenschaft5
amp -informatik campus5
beitrge 281k unterforen5
281k unterforen master5
beitrge 281k plaudereckenbsphallo5
kommunikations- und rechnernetze5
informationssysteme und ki5
32651 betriebliche steuerplanung5
sektorales marketing 316615
heute um 10255
operations research belegt5
202021 optimierungsmethoden des5
31031 internes rechnungswesen5
31901 ffentliche ausgaben5
ws 202021 optimierungsmethoden5
31511 finanzwirtschaft vertiefung5
marktforschung und sektorales5
marketing 31631 marktforschung5
des marketing 316315
studierende der fernuni5
vertiefung 31521 finanzintermediation5
finanzwirtschaft vertiefung 315215
computer und mensch5
wirtschaftsmathe und statistik5
dl-prozesse 32791 dienstleistungsmanagement4
32691 dienstleistungsmanagement dl-prozesse4
supply chains 328614
dienstleistungsmanagement dl-prozesse 327914
steuerplanung 32671 zukunftsweisende4
risikomanagement in supply4
wirtschaftsprfung 32851 risikomanagement4
32841 wirtschaftsprfung 328514
kreditrisikom 32841 wirtschaftsprfung4
kundenbeziehung 32831 finanzw4
u kreditrisikom 328414
32791 dienstleistungsmanagement kundenbeziehung4
bewertungstheorie u kreditrisikom4
32671 zukunftsweisende fhrung4
strategisches und internationales4
finanzw bewertungstheorie u4
dienstleistungsmanagement kundenbeziehung 328314
32831 finanzw bewertungstheorie4
betriebliche steuerplanung 326714
themen 14 beitrge4
chains 32861 finanzmanagement4
32591 konzerncontrolling 326014
informationsvisualisierung im internet4
engineering und programmiers4
um 1025 noori4
research belegt heute4
u int finanzwissensch4
allokationstheorie u int4
32771 allokationstheorie u4
zeitreihenanalyse und kapitalmarktforschung4
61115 mathematische grundlagen4
mathematische grundlagen der4
grundlagen der kryptografie4
32861 finanzmanagement mit4
theorie der politik4
konomische theorie der4
32571 konomische theorie4
61412 lineare optimierung4
auf unvollkommenen mrkten4
preisbildung auf unvollkommenen4
32531 preisbildung auf4
anreize 32531 preisbildung4
konomische anreize 325314
steuern und konomische4
finanzmanagement mit excel4
konzerncontrolling 32601 strategisches4
grundlagen der informatik4
unternehmensbewertung 32591 konzerncontrolling4
ii 31031 internes4
0 beitrge 04
seminare und bachelorarbeit4
wirtschaftspolitik 31901 ffentliche4
europische wirtschaftspolitik 319014
u unternehmensbewertung 325914
31951 digitale transformation4
konzernrechnungslegung 31951 digitale4
31921 konzernrechnungslegung 319514
bwl ii 310314
themen 22k beitrge4
finanzierung bwl ii4
investition und finanzierung4
bwl i 310214
externes rechnungswesen bwl4
wirtschaftswissenschaft 31011 externes4
themen 0 beitrge4
wirtschaftswissenschaft fernuni hagen4
unterforen wirtschaftswissenschaft fernuni4
themen 32k beitrge4
digitale transformation wahlpflichtmodule4
vertiefende konzepte von4
wahlpflichtmodule betriebswirtschaft bachelormodul4
wahlpflichtmodule betriebswirtschaft mastermodule4
finanz- und bankwirtschaftliche4
konzepte von datenbanksystemen4
investitionstheorie u unternehmensbewertung4
32581 investitionstheorie u4
fachpraktikum fr sichere3
moving objects databases3
katalog m1 grundlagen3
fachpraktikum prozessmodellierungswerkzeuge fachpraktikum3
fachpraktikum mensch-computer-interaktion fachpraktikum3
fachpraktikum erweiterbare datenbanksysteme3
erweiterbare datenbanksysteme fachpraktikum3
fachpraktikum cscw fachpraktikum3
datenstrukturen und datenbanken3
dokumenten- und wissensmanagement3
katalog m3 informationssysteme3
methoden der wissensreprsentation3
datenbanken in rechnernetzen3
deduktions- und inferenzsysteme3
seminare und abschlussarbeit3
m1 grundlagen der3
campus informatik seminare3
fachpraktikum field programmable3
informatik campus informatik3
plauderecke informatik campus3
master geschichte europas3
europa und die3
master europische moderne3
field programmable gate3
programmable gate arrays3
gate arrays fachpraktikum3
fachpraktikum internetsicherheit fachpraktikum3
fachpraktikum programmiersysteme fachpraktikum3
grundlegende algorithmen der3
fachpraktikum simulation von3
ps b vertiefung3
b vertiefung software3
programmiertechniken und -methoden3
katalog m7 computer3
ps a vertiefung3
logisches und funktionales3
m4 software engineering3
gestaltung kooperativer systeme3
katalog m2 computersysteme3
optimierung katalog m23
computeruntersttztes koop arbeiten3
arbeiten und lernen3
fachpraktikum parallel programming3
simulation von diskreten3
algorithmen der bio-informatik3
von diskreten produktions3
lineare optimierung katalog3
diskreten produktions fachpraktikum3
multimedia- und internetanwendungen3
katalog m4 software3
sicherheit safety amp3
kryptografie 61412 lineare3
der kryptografie 614123
safety amp security3
master praktische informatik3
letzte noori heute3
fachpraktikum theoretische informatik3
theoretische informatik fachpraktikum3
einfhrung in den3
fhrung 32691 dienstleistungsmanagement3
sozialwissenschaften campus bachelor3
ws 202021 informationsmanagement3
modellierung von informationssystemen3
von informationssystemen 317713
informationssystemen 31771 informationsmanagement3
31781 probleme der3
probleme der wirtschaftspolitik3
der wirtschaftspolitik 317913
wirtschaftspolitik 31791 industriekonomik3
202021 informationsmanagement belegt3
markt und staat3
heute um 10173
einfhrung in mensch-computer-interaktion3
betriebswirtschaft bachelormodul 315113
bachelormodul 31511 finanzwirtschaft3
31561 dienstleistungskonzeptionen 315813
dienstleistungskonzeptionen 31581 unternehmensgrndung3
31581 unternehmensgrndung 316113
31751 modellierung von3
instrumente des controlling3
betriebswirtschaft mastermodule 325213
wiwi diskussion seminare3
bestehe ich die3
studium an der3
mathematik und informatik3
-informatik campus wirtschaftswissenschaft3
campus wirtschaftswissenschaft seminare3
wirtschaftswissenschaft seminare amp3
abschlussarbeit wiwi diskussion3
diskussion seminare amp3
31601 instrumente des3
abschlussarbeit wiwi erfahrungsberichte3
31041 theorie der3
theorie der marktwirtschaft3
der marktwirtschaft 310513
marktwirtschaft 31051 makrokonomik3
31101 grundlagen wirtschaftsmathe3
bankmanagement 31541 produktionsplanung3
unternehmensgrndung 31611 innovationscontrolling3
mastermodule 32521 finanz-3
heute um 08373
hausarbeit und falltraining3
bankmanagement 31561 dienstleistungskonzeptionen3
mastermodule 32511 steuern3
advanced parallel computing3
unterforen rechtswissenschaft fernuniversitt3
hagen plauderecke rechtswissenschaft3
plauderecke rechtswissenschaft campus3
private lerngruppen hausarbeit3
einfhrung in das3
32731 angewandte konometrie3
55110 int privatrecht3
privatrecht und zivilprozessrecht3
b aktuelle eanbspws3
aktuelle eanbspws 2020213
eanbspws 202021 ea3
202021 ea ke3
ea ke 13
1025 noori master3
trade and economic3
internationales marketing 326413
excel wahlpflicht vwl3
marketing 32641 internationales3
32641 internationales management3
internationales management 326513
management 32651 betriebliche3
zukunftsweisende fhrung 326913
wie bestehe ich3
mit excel wahlpflicht3
entwurf und implem3
32721 international trade3
implem von informationssystemen3
der politik 326213
politik 32621 optimierungsmethoden3
operations research 326613
research 32661 stabilittspolitik3
32661 stabilittspolitik 326813
stabilittspolitik 32681 zeitreihenanalyse3
32711 business intelligence3
noori heute um3
fernuni hagen25
software engineering18
oktober 202016
geschichte europas15
heute um15
der fernuni14
grundlagen der13
hagen plauderecke12
plauderecke kultur-12
sozialwissenschaften campus11
optimierungsmethoden des11
des operations11
operations research11
2020 chihfengbrian11
4 oktober11
europas 411
ma geschichte11
im ws10
grundlagen des10
wahlpflichtmodule betriebswirtschaft10
beitrge 281k10
vertiefung software9
hat im9
sonstigesnbspwer hat9
ws 2020219
des marketing8
n sonstigesnbspwer8
msc themen8
unterforen master8
seminare amp8
amp abschlussarbeit8
mathematische grundlagen7
campus master7
31701 personalfhrung7
theorie der7
chihfengbrian master7
31621 grundlagen7
ma themen7
externes rechnungswesen6
31011 externes6
um time6
organisationen 319116
31561 dienstleistungskonzeptionen6
31911 jahresabschluss6
jahresabschluss nach6
31521 finanzintermediation6
nach hgb6
ifrs 319216
31921 konzernrechnungslegung6
von informationssystemen6
belegt heute6
wahlpflicht vwl6
unterforen bachelor6
vermgensermittlung 317016
31681 grundl6
grundl besteuerung6
betr steuerpolitik6
steuerpolitik 316916
31691 steuerliche6
im internet6
steuerliche gewinn-6
plauderecke wirtschaftswissenschaft6
31711 verhalten6
wirtschaftswissenschaft amp6
amp -informatik6
32621 optimierungsmethoden6
der politik6
innovationscontrolling 316216
31611 innovationscontrolling6
personalfhrung 317116
abschlussarbeit wiwi6
instrumente 316815
31741 konomie5
u softwaresystemen5
konomie der5
betriebliche steuerplanung5
parallel programming5
der moderne5
281k plaudereckenbsphallo5
281k unterforen5
schwerpunktbereich ejp5
campus bachelor5
um 10255
research belegt5
202021 optimierungsmethoden5
32841 wirtschaftsprfung5
32651 betriebliche5
der umweltpolitik5
32591 konzerncontrolling5
pflichtmodule master5
theorien strategien5
ffentliche ausgaben5
31901 ffentliche5
europische wirtschaftspolitik5
31851 europische5
knowledge management5
31831 knowledge5
graphischen strukturen5
31801 problemlsen5
strategien instrumente5
neue beitrge5
planung theorien5
31581 unternehmensgrndung5
bsc themen5
31671 planung5
31031 internes5
funkt steuerung5
studierende der5
31511 finanzwirtschaft5
finanzwirtschaft vertiefung5
vertiefung 315215
internes rechnungswesen5
-informatik campus5
sektorales marketing5
31661 organisation5
organisation theorie5
theorie gestaltung5
marketing 316615
wandel 316715
31631 marktforschung5
marketing 316315
gestaltung wandel5
chains 328614
32861 finanzmanagement4
finanzmanagement mit4
auf unvollkommenen4
mit excel4
themen 22k4
quantitative mastermodule4
32511 steuern4
preisbildung auf4
32851 risikomanagement4
konomische anreize4
anreize 325314
32531 preisbildung4
supply chains4
u kreditrisikom4
wirtschaftsprfung 328514
dl-prozesse 327914
wirtschaftswissenschaft fernuni4
unterforen wirtschaftswissenschaft4
steuerplanung 326714
32671 zukunftsweisende4
zukunftsweisende fhrung4
32691 dienstleistungsmanagement4
32791 dienstleistungsmanagement4
22k beitrge4
dienstleistungsmanagement kundenbeziehung4
kundenbeziehung 328314
32831 finanzw4
finanzw bewertungstheorie4
bewertungstheorie u4
32571 konomische4
kreditrisikom 328414
unvollkommenen mrkten4
master mathematik4
konomische theorie4
methoden der4
beitrge 283k4
master bildung4
fr die4
ich habe4
ich die4
europische moderne4
61115 mathematische4
gibt es4
der kryptografie4
61412 lineare4
lineare optimierung4
themen 04
0 beitrge4
beitrge 04
beitrge 282k4
ba themen4
14 beitrge4
internationales marketing4
themen 144
32661 stabilittspolitik4
bachelor mathematik4
allokationstheorie u4
u int4
int finanzwissensch4
plauderecke rechtswissenschaft4
besonderer teil4
1025 noori4
dsl engineering4
informationsvisualisierung im4
sicherheit safety4
parallel computing4
effiziente graphenalgorithmen4
allgemeiner teil4
32681 zeitreihenanalyse4
32771 allokationstheorie4
32601 strategisches4
finanzierung bwl4
vertiefende konzepte4
der informatik4
wissensbasierte systeme4
32k beitrge4
themen 32k4
wirtschaftswissenschaft 310114
rechnungswesen bwl4
31021 investition4
bwl ii4
von datenbanksystemen4
ii 310314
wirtschaftspolitik 319014
konzerncontrolling 326014
31771 informationsmanagement4
transformation wahlpflichtmodule4
digitale transformation4
31951 digitale4
konzernrechnungslegung 319514
31541 produktionsplanung4
konzepte von4
dienstleistungsmanagement dl-prozesse4
verteilte systeme4
bankwirtschaftliche modelle4
noori master4
betriebswirtschaft mastermodule4
u unternehmensbewertung4
interaktive systeme4
32521 finanz-4
betriebswirtschaft bachelormodul4
unternehmensbewertung 325914
investitionstheorie u4
32581 investitionstheorie4
der wissensreprsentation3
amp security3
m3 informationssysteme3
katalog m33
safety amp3
virtuelle maschinen3
moving objects3
vertiefung datenstrukturen3
objects databases3
katalog m23
katalog m43
m4 software3
funktionales programmieren3
mit der3
ps b3
b vertiefung3
ps c3
m2 computersysteme3
kryptografie 614123
optimierung katalog3
vor ort3
31721 markt3
unterforen informatik3
plauderecke informatik3
informatik campus3
campus informatik3
informatik seminare3
abschlussarbeit informatik3
wie bestehe3
informatik katalog3
systeme katalog3
32641 internationales3
katalog m13
m1 grundlagen3
grundlegende algorithmen3
algorithmen der3
der bio-informatik3
algorithmische geometrie3
management 326513
katalog m73
internationales management3
moderne programmiertechniken3
computeruntersttztes koop3
m7 computer3
numerische mathematik3
fachpraktikum internetsicherheit3
internetsicherheit fachpraktikum3
fachpraktikum field3
field programmable3
programmable gate3
gate arrays3
arrays fachpraktikum3
fachpraktikum fr3
fr sichere3
bankmanagement 315413
fachpraktikum cscw3
marketing 326413
31601 instrumente3
instrumente des3
master praktische3
praktische informatik3
des controlling3
belegt letzte3
letzte noori3
noori heute3
cscw fachpraktikum3
datenbanksysteme fachpraktikum3
gestaltung kooperativer3
fachpraktikum multimedia-3
kooperativer systeme3
master philosophie3
koop arbeiten3
fachpraktikum parallel3
fachpraktikum simulation3
simulation von3
von diskreten3
diskreten produktions3
produktions fachpraktikum3
internetanwendungen fachpraktikum3
erweiterbare datenbanksysteme3
fachpraktikum theoretische3
theoretische informatik3
informatik fachpraktikum3
fachpraktikum programmiersysteme3
programmiersysteme fachpraktikum3
fachpraktikum prozessmodellierungswerkzeuge3
prozessmodellierungswerkzeuge fachpraktikum3
fachpraktikum mensch-computer-interaktion3
mensch-computer-interaktion fachpraktikum3
fachpraktikum erweiterbare3
master soziologie3
31501 finanzwirtschaft3
master governance3
economic development3
september 20203
research 326613
202021 informationsmanagement3
stabilittspolitik 326813
32711 business3
business intelligence3
32721 international3
international trade3
32731 angewandte3
unternehmensgrndung 316113
angewandte konometrie3
mastermodule 325213
fhrung 326913
55105 arbeitsvertragsrecht3
hagen themen3
sind die3
31041 theorie3
bankmanagement 315613
mastermodule 325113
informationsmanagement belegt3
gestern um3
hat sich3
betriebliche informationssysteme3
wirtschaftswissenschaft seminare3
wiwi diskussion3
campus wirtschaftswissenschaft3
diskussion seminare3
excel wahlpflicht3
wahlpflichtmodule informatik3
quantitative bachelormodule3
31311 it-governance3
wiwi erfahrungsberichte3
pflichtmodule wirtschaftswissenschaft3
politik 326213
31001 einfhrung3
bachelormodul 315113
dienstleistungskonzeptionen 315813
bachelor wirtschaftsinformatik3
32561 entwurf3
implem von3
um 10173
die wirtschaftswissenschaft3
zu besuch3
master wirtschaftsinformatik3
der marktwirtschaft3
master geschichte3
informationssystemen 317713
ffentliches recht3
ist nicht3
arbeitsrecht ii3
bachelor kulturwissenschaften3
probleme der3
31781 probleme3
den studiengang3
bachelor bildungswissenschaft3
die wirtschaftsinformatik3
um 08373
modellierung von3
seiten ca3
31751 modellierung3
erfahrungen mit3
31101 grundlagen3
grundlagen wirtschaftsmathe3
master europische3
bestehe ich3
die welt3
allgemeine tipps3
ke 13
marktwirtschaft 310513
lerngruppen hausarbeit3
auf die3
31051 makrokonomik3
advanced parallel3
31071 einfhrung3
31791 industriekonomik3
unterforen rechtswissenschaft3
rechtswissenschaft fernuniversitt3
rechtswissenschaft campus3
private lerngruppen3
einfhrung wiwi3
ea ke3
wirtschaftspolitik 317913
teil des3
der wirtschaftspolitik3
55110 int3
int privatrecht3
b aktuelle3
aktuelle eanbspws3
eanbspws 2020213
202021 ea3
grundstrukturen der3
der110
beitrge88
themen84
die83
master41
fachpraktikum40
grundlagen39
hagen37
im36
ich35
einfhrung35
informatik34
fernuni31
unterforen30
von30
um30
des30
fr28
plauderecke28
zu27
wirtschaftswissenschaft27
025
campus25
mit25
amp24
u24
bachelor24
katalog23
wahlpflichtmodule23
engineering22
vertiefung22
geschichte22
seminare22
software22
auf21
wie20
oktober19
ist18
systeme18
es18
ma18
marketing17
nicht17
wirtschaftsinformatik17
mathematik17
pflichtmodule16
116
philosophie15
hat15
wiwi15
kultur-15
true15
heute15
europas15
den14
abschlussarbeit14
moderne14
rechtswissenschaft14
sich14
214
ii14
psychologie14
sozialwissenschaften14
management13
theorie13
du13
ejp13
313
ws12
m12
lernen12
412
ein12
quantitative12
das11
bildung11
modul11
organisation11
research11
operations11
optimierungsmethoden11
mastermodule11
chihfengbrian11
rechnungswesen11
plaudereckenbsphallo11
politik10
ps10
staat10
eine10
betriebswirtschaft10
alle10
europische10
soziologie10
vor10
281k10
sonstigesnbspwer10
man10
masterarbeit9
b9
59
als9
bwl9
medien9
noori9
belegt9
n9
wahlpflicht9
konomische9
statistik9
vwl9
oder9
mathematische9
methoden9
grundl9
nach9
studium9
gestaltung9
parallel9
recht8
teil8
bei8
dienstleistungsmanagement8
betriebliche8
fernuniversitt8
wirtschaftspolitik8
habe8
int8
strafrecht8
hier8
msc8
internationales8
instrumente8
finanzwirtschaft8
wir8
steuerung8
informationssysteme8
programmierung7
diskussion7
verhalten7
personalfhrung7
theorien7
67
77
informationsmanagement7
arbeitsrecht7
m27
neue7
tipps7
studierende7
noch7
time7
verwaltung7
fernuni-hilfe7
arbeit7
allgemeine7
arbeiten7
m17
letzte6
86
governance6
96
bachelorarbeit6
externes6
dienstleistungskonzeptionen6
106
aber6
116
126
bankmanagement6
jahresabschluss6
m46
ifrs6
erfahrungsberichte6
hgb6
international6
konomie6
136
strukturen6
informationssystemen6
bachelormodule6
organisationen6
146
finanzintermediation6
auch6
internet6
zur6
lineare6
law6
-informatik6
computing6
steuerliche6
mensch-computer-interaktion6
156
steuerpolitik6
sind6
vermgensermittlung6
suche6
wirtschaft6
wandel6
betr6
supply6
besteuerung6
gewinn-6
so6
sicherheit6
datenbanken6
166
gesellschaft6
steuern6
finanzierung6
176
zum6
konzernrechnungslegung6
innovationscontrolling6
186
community6
computersysteme6
theoretische6
ab6
mir6
programming5
ki5
195
mich5
wirtschaftsprfung5
205
modelle5
steuerplanung5
nur5
bitte5
dass5
algorithmen5
datenstrukturen5
215
softwaresystemen5
entscheidungsmethoden5
algorithmische5
optimierung5
ber5
computer5
liebe5
klausuren5
ausgaben5
ffentliche5
225
knowledge5
235
graphischen5
problemlsen5
245
seit5
mensch5
umweltpolitik5
255
265
haben5
strategien5
bildungswissenschaft5
rechnernetze5
seminar5
funkt5
schwerpunktbereich5
internes5
entwurf5
275
soziale5
module5
keine5
gibt5
zivilprozessrecht5
europa5
d5
unternehmensrecht5
bsc5
kommunikations-5
285
latex5
kulturwissenschaften5
praktische5
konzerncontrolling5
ffentliches5
da5
klausur5
295
m75
m35
305
wirtschaftsmathe5
unternehmensgrndung5
fragen5
315
marktforschung5
sektorales5
325
335
planung5
pc-technologie4
strategisches4
kulturphilosophie4
kreditrisikom4
bewertungstheorie4
344
privatrecht4
fhrung4
politische4
allgemeiner4
ba4
private4
graphenalgorithmen4
finanzw4
354
364
kundenbeziehung4
374
security4
zukunftsweisende4
effiziente4
em4
dl-prozesse4
finanzwissensch4
safety4
unvollkommenen4
kapitalmarktforschung4
zeitreihenanalyse4
384
preisbildung4
394
programmiers4
mrkten4
anreize4
404
stabilittspolitik4
414
af4
c4
schuldrecht4
angewandte4
424
434
chains4
betriebssysteme4
informationsvisualisierung4
dsl4
444
iii4
risikomanagement4
kryptografie4
283k4
282k4
allokationstheorie4
454
finanzmanagement4
excel4
464
474
besonderer4
middlead4
484
hilfe4
494
makrokonomik4
investition4
504
forum4
22k4
514
524
ihr4
september4
august4
studiengang4
hausarbeit4
dich4
geht4
534
dem4
teilen4
business4
seiten4
544
seite4
mehr4
werden4
554
unternehmensbewertung4
wieder4
sie4
meine4
viele4
unibibliothek4
produktionsplanung4
36k4
32k4
finanz-4
einen4
wissensbasierte4
bersetzerbau4
vertiefende4
konzepte4
datenbanksystemen4
564
verteilte4
interaktive4
bachelormodul4
574
modellierung4
transformation4
bankwirtschaftliche4
584
digitale4
investitionstheorie4
erfolgreich3
war3
b33
welt3
lesen3
februar3
false3
browser3
b43
steuerberaterprfung3
schriftliche3
bestehe3
semester3
v3
folgenden3
wissenschaftliche3
wei3
studienphase3
empirische3
regieren3
durchsuchen3
einer3
ca3
letzten3
wenn3
midad3
m53
wrter3
artikel3
mchten3
erfahrungen3
prozessmodellierungswerkzeuge3
bio-informatik3
komplexittstheorie3
kooperativer3
dokumenten-3
wissensmanagement3
logisches3
funktionales3
programmieren3
fernuni-hilfede3
programmiertechniken3
-methoden3
computeruntersttztes3
cscw3
datenbanksysteme3
koop3
diese3
simulation3
diskreten3
produktions3
erweiterbare3
multimedia-3
internetanwendungen3
inferenzsysteme3
deduktions-3
grundlegende3
programmable3
programmiersysteme3
geometrie3
numerische3
erst3
sichere3
arrays3
ort3
gate3
einem3
virtuelle3
rechnernetzen3
maschinen3
multimediainformationssysteme3
wissensreprsentation3
field3
moving3
internetsicherheit3
b23
objects3
databases3
grundstrukturen3
vm3
verwaltungsw3
593
privat-3
603
intelligence3
613
623
trade3
economic3
development3
marktwirtschaft3
633
konometrie3
643
653
wettbewerbsrecht3
663
arbeitsvertragsrecht3
673
lernmaterial3
g3
683
iv3
gestern3
693
703
rechnungslegung3
it-governance3
713
723
internationale3
globalisierung3
industriekonomik3
probleme3
733
743
foren3
753
markt3
763
773
implem3
controlling3
783
besuch3
793
euch3
kann3
bernat3
zivilrecht3
wahlmodule3
immer3
evm3
historische3
kultur3
kulturelle3
literaturwissenschaft3
ke3
literatur3
klausureinsicht3
literarische3
bekommen3
online3
p33
datev3
sozialphilosophie3
perspektiven3
08373
ea3
sz3
gerade3
advanced3
juli3
s3
prfung3
laws3
damit3
lerngruppen3
falltraining3
klausurvorbereitung3
eanbspws3
formeln3
803
insolvenzrecht3
813
verwaltungsrecht3
rhetorik3
webseite3
wirtschaftsrecht3
aktuelle3
startseite3

Who hosts Fernuni-hilfe.de?

Fernuni-hilfe.de Hosting Provider Information

Hosted IP Address:85.13.128.8
Hosted Hostname:dd1012.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Neue Medien Muennich GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Neue Medien Muennich GmbH
0.4364%

HTTP Header Analysis for Fernuni-hilfe.de

Http-Version: 1.1
Status-Code: 302
Status: 302 Found
Date: Mon, 26 Oct 2020 10:38:21 GMT
Server: Apache
Location: https://www.fernuni-hilfe.de/
Content-Length: 213
Content-Type: text/html; charset=iso-8859-1

Fernuni-hilfe.de Domain Nameserver Information

HostIP AddressCountry
ns5.kasserver.com 85.13.128.3
ns6.kasserver.com 85.13.159.101


Need to find out who hosts Fernuni-hilfe.de?


Domain Registration (WhoIs) information for Fernuni-hilfe.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: fernuni-hilfe.de
Nserver: ns5.kasserver.com
Nserver: ns6.kasserver.com
Status: connect
Changed: 2018-01-13T02:01:08+01:00

Websites with Similar Names

Fernum-robotics.com
Fernum Robotics – Easy to use and low cost humanoid robots
Fernumzuege.shop
fernumzuege.shop
Fernuni-forum.de
Forum für Fernuni Studierende in WiWi bei Fernstudium Guide
Fernuni-hage.de
fernuni-hage.de jetzt kaufen!
Fernuni-hagen-hims.de
FernUni Hagen bietet Masterstudium in Management und BWL
Fernuni-hagen.de
FernUniversität in Hagen - Startseite
Fernuni-hilfe.de
Fernuni-Hilfe.de | FernUni Hagen Forum & Community
Fernuni.ch
FernUni Schweiz - fernuni.ch
Fernunis.com
秋霞手机看片网站_最新伦理片_好看的伦理电影免费在线观看
Fernunterricht.info
fernunterricht.info

Recently Updated Websites

Yaqivip4246.app (1 second ago.)Onlyname.com (1 second ago.)Scientificaerican.com (2 seconds ago.)Orderbestpizzamenu.com (2 seconds ago.)Venividilibri.org (2 seconds ago.)Yibovip3240.app (3 seconds ago.)Weaddict.com (3 seconds ago.)2016riobrasil.com (4 seconds ago.)Comparannonce.com (4 seconds ago.)Hotelshine.ge (4 seconds ago.)Startpoint.gr (5 seconds ago.)Affordableusedcarsonslow.com (6 seconds ago.)Badmessages.com (6 seconds ago.)Findcapital.org (6 seconds ago.)Layout-24.com (7 seconds ago.)Feelgoodartisanhardseltzer.com (9 seconds ago.)Ndgu.space (9 seconds ago.)Rwcp.video (9 seconds ago.)Thaitida.com (9 seconds ago.)Lacitytacos.com (10 seconds ago.)Pxecvp.club (10 seconds ago.)Mikejonbyers.com (10 seconds ago.)Pluchis.com (11 seconds ago.)Mon-chemin-chansons.com (11 seconds ago.)Getmailtastic.com (11 seconds ago.)6667754.com (11 seconds ago.)Basicsofbirding.com (12 seconds ago.)Varelianos.com (12 seconds ago.)Bishopmarcushill.net (12 seconds ago.)Planacirculo.com (12 seconds ago.)

Recently Searched Keywords

电子电工系列 (1 second ago.)planning irs (1 second ago.)техника и связь (1 second ago.)pas-de-calais (2 seconds ago.)przesyki (2 seconds ago.)вышивка (2 seconds ago.)67290 (4 seconds ago.)gearbest (6 seconds ago.)todas as linhas da cptm (9 seconds ago.)38505005.com (10 seconds ago.)background-positionleft top (13 seconds ago.)freehacks onion url (13 seconds ago.)javascript pour (14 seconds ago.)ppc services (15 seconds ago.)今晚和繼母單獨在家 (16 seconds ago.)balantilar yararl balantlar (16 seconds ago.)когда в петербурге наступит пик заболеваемости коронавирусом и скоро ли откроют границы с финляндией (17 seconds ago.)��ƷУ����ְ��ҵ�����鼮�Ƽ� (17 seconds ago.)used were perfect (18 seconds ago.)伊勢 (21 seconds ago.)2020-07-07 (22 seconds ago.)dnf��� (23 seconds ago.)sassan dieter khatib-shahidi (24 seconds ago.)can grow (25 seconds ago.)когда в петербурге наступит пик заболеваемости коронавирусом и скоро ли откроют границы с финляндией (25 seconds ago.)mandat pour coach-attitude (28 seconds ago.)16pxu003ewe (29 seconds ago.)me i have (29 seconds ago.)facts useful (30 seconds ago.)august 29 2007 (31 seconds ago.)