Final-memory.org Favicon Final-memory.org

Final-memory.org Website Thumbnail
Checking...
.:: Final Memory ::.
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
final-memory
Domain extension
org
Domain registered:
2007-02-07
Domain updated:
2020-10-26
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is final-memory.org ranked relative to other sites:

Percentage of visits to final-memory.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Final-memory.org registered?
A: Final-memory.org was registered 13 years, 8 months, 2 weeks, 6 days, 12 hours, 47 minutes, 41 seconds ago on Wednesday, February 7, 2007.
Q: When was the WHOIS for Final-memory.org last updated?
A: The WHOIS entry was last updated 1 day, 12 hours, 47 minutes, 41 seconds ago on Monday, October 26, 2020.
Q: What are Final-memory.org's nameservers?
A: DNS for Final-memory.org is provided by the following nameservers:
  • ns6.kasserver.com
  • ns5.kasserver.com
Q: Who is the registrar for the Final-memory.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Final-memory.org?
A: Final-memory.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Final-memory.org each day?
A: Final-memory.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Final-memory.org resolve to?
A: Final-memory.org resolves to the IPv4 address 85.13.155.167.
Q: In what country are Final-memory.org servers located in?
A: Final-memory.org has servers located in the Germany.
Q: What webserver software does Final-memory.org use?
A: Final-memory.org is powered by Apache webserver.
Q: Who hosts Final-memory.org?
A: Final-memory.org is hosted by Neue Medien Muennich GmbH in Germany.
Q: How much is Final-memory.org worth?
A: Final-memory.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Final-memory.org?

Final-memory.org Hosting Provider Information

Hosted IP Address:85.13.155.167
Hosted Hostname:dd39420.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Neue Medien Muennich GmbH" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Final-memory.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 26 Oct 2020 14:29:33 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Final-memory.org Domain Nameserver Information

HostIP AddressCountry
ns6.kasserver.com 85.13.159.101
ns5.kasserver.com 85.13.128.3


Need to find out who hosts Final-memory.org?


WhoIs information for Final-memory.org

 Domain Name: FINAL-MEMORY.ORG
Registry Domain ID: D148389419-LROR
Registrar WHOIS Server:
Registrar URL: http://www.registrygate.com
Updated Date: 2019-07-03T01:24:54Z
Creation Date: 2007-07-02T11:51:15Z
Registry Expiry Date: 2020-07-02T11:51:15Z
Registrar Registration Expiration Date:
Registrar: RegistryGate GmbH
Registrar IANA ID: 1328
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province:
Registrant Country: DE
Name Server: NS5.KASSERVER.COM
Name Server: NS6.KASSERVER.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-05-31T08:29:06Z

Final-memory.org Free SEO Report

Website Inpage Analysis for Final-memory.org

H1 Headings

1 :
  1. .:: Final Memory ::.

H2 Headings

24 :
  1. STM32 “Blue pill” mit SEGGER Embedded Studio
  2. SNES2DB9 auf Github
  3. SNES2DB9 Arduino Prototyp
  4. Steambox im Eigenbau – Teil 2
  5. Steambox im Eigenbau – Teil 1
  6. STM32 HAL Library für die “Blue pill”
  7. WordPress 5 und der klassische Editor
  8. Binary to Wozmon
  9. Abstract
  10. System requirements
  11. Usage
  12. Example
  13. Download
  14. Apple 1 Emulation von Peter Sieg ausprobiert
  15. Rezept für Biryani Masala Gewürzmischung
  16. Wetter Friedrichshafen
  17. Pages
  18. Categories
  19. Atari
  20. Blogroll
  21. Friends
  22. Raumfahrt
  23. Rock'n'Roll
  24. Meta

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

10 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

86:
  1. .:: Final Memory ::.
    http://www.final-memory.org
  2. STM32 “Blue pill” mit SEGGER Embedded Studio
    http://www.final-memory.org/?p=2804
  3. Embedded Systems
    http://www.final-memory.org/?cat=74
  4. Mikrocontroller
    http://www.final-memory.org/?cat=35
  5. STM32
    http://www.final-memory.org/?cat=103
  6. SNES2DB9 auf Github
    http://www.final-memory.org/?p=2801
  7. ANSI C & C99
    http://www.final-memory.org/?cat=76
  8. Arduino
    http://www.final-memory.org/?cat=87
  9. ASM Software
    http://www.final-memory.org/?cat=27
  10. AVR
    http://www.final-memory.org/?cat=57
  11. Elektronik
    http://www.final-memory.org/?cat=7
  12. GitHub
    http://www.final-memory.org/?cat=98
  13. SNES2DB9 Arduino Prototyp
    http://www.final-memory.org/?p=2792
  14. Atari ST
    http://www.final-memory.org/?cat=12
  15. Steambox im Eigenbau – Teil 2
    http://www.final-memory.org/?p=2788
  16. mein neues Steamboxprojekt
    http://www.final-memory.org/?p=2782
  17. Daddeln
    http://www.final-memory.org/?cat=23
  18. Hardware
    http://www.final-memory.org/?cat=63
  19. IT
    http://www.final-memory.org/?cat=25
  20. Linux
    http://www.final-memory.org/?cat=24
  21. Steam
    http://www.final-memory.org/?cat=101
  22. Steambox im Eigenbau – Teil 1
    http://www.final-memory.org/?p=2782
  23. meine Alienware Alpha
    http://www.final-memory.org/?page_id=2702
  24. der Acer AS X1301-3, den ich im Mai 2010 gekauft habe
    http://www.final-memory.org/?p=1550
  25. STM32 HAL Library für die “Blue pill”
    http://www.final-memory.org/?p=2773
  26. CMake
    http://www.final-memory.org/?cat=83
  27. WordPress 5 und der klassische Editor
    http://www.final-memory.org/?p=2775
  28. Binary to Wozmon
    http://www.final-memory.org/?p=2769
  29. Apple 1
    http://www.final-memory.org/?cat=102
  30. Apple 1 Emulation von Peter Sieg ausprobiert
    http://www.final-memory.org/?p=2762
  31. Rezept für Biryani Masala Gewürzmischung
    http://www.final-memory.org/?p=2760
  32. Rezepte
    http://www.final-memory.org/?cat=20
  33. « Previous Entries
    http://www.final-memory.org/?paged=2
  34. 3
    http://www.final-memory.org/?m=20201003
  35. 4
    http://www.final-memory.org/?m=20201004
  36. « Sep
    http://www.final-memory.org/?m=202009
  37. About
    http://www.final-memory.org/?page_id=2
  38. Alienware Alpha Review
    http://www.final-memory.org/?page_id=2702
  39. ASM Software
    http://www.final-memory.org/?page_id=79
  40. DOs and DO NOTs for developing Embedded Systems software
    http://www.final-memory.org/?page_id=2113
  41. Quadromania
    http://www.final-memory.org/?page_id=1193
  42. SNES2DB9
    http://www.final-memory.org/?page_id=2799
  43. Software für MSDOS
    http://www.final-memory.org/?page_id=1831
  44. Tips und Tricks mit der GNU/Linux Kommandozeile
    http://www.final-memory.org/?page_id=2631
  45. Wissenssammlung ANSI C
    http://www.final-memory.org/?page_id=1940
  46. Atari Powerpack instructions
    http://www.final-memory.org/?page_id=848
  47. Contact
    http://www.final-memory.org/?page_id=16
  48. Curriculum Vitae
    http://www.final-memory.org/?page_id=147
  49. Fotoalbum
    http://www.final-memory.org/?page_id=192
  50. Abi 99
    http://www.final-memory.org/?page_id=264
  51. Kohltour 2006
    http://www.final-memory.org/?page_id=200
  52. Kohltour 2008
    http://www.final-memory.org/?page_id=265
  53. Sommerparty 2006
    http://www.final-memory.org/?page_id=203
  54. Atari
    http://www.final-memory.org/?page_id=259
  55. Atari 2600
    http://www.final-memory.org/?page_id=309
  56. Clausthal
    http://www.final-memory.org/?page_id=260
  57. 26. Geburtstag
    http://www.final-memory.org/?page_id=197
  58. 28.Geburtstag Christian Hausknecht
    http://www.final-memory.org/?page_id=198
  59. Lehrbergwerk Grube Rote Bär
    http://www.final-memory.org/?page_id=261
  60. Chilikochen 28.3.2006
    http://www.final-memory.org/?page_id=199
  61. Spass mit dem G
    http://www.final-memory.org/?page_id=193
  62. Schnitzelabend 1.6.2006
    http://www.final-memory.org/?page_id=202
  63. Familie
    http://www.final-memory.org/?page_id=262
  64. Bamberg 2006
    http://www.final-memory.org/?page_id=195
  65. Bamberg 2007
    http://www.final-memory.org/?page_id=196
  66. Ellens Taufe 22.8.-24.8.2008
    http://www.final-memory.org/?page_id=276
  67. Mit Sabine in Zürich 2.4.2010
    http://www.final-memory.org/?page_id=1426
  68. Spanien 2007
    http://www.final-memory.org/?page_id=204
  69. Friedrichshafen
    http://www.final-memory.org/?page_id=263
  70. Abteilungsausflug 18.9.2008
    http://www.final-memory.org/?page_id=312
  71. Lindau 5.4.2009
    http://www.final-memory.org/?page_id=565
  72. Meersburg 3.4.2011
    http://www.final-memory.org/?page_id=2099
  73. Pfänder 14.06.2009
    http://www.final-memory.org/?page_id=675
  74. Schloss Salem 22.06.2008
    http://www.final-memory.org/?page_id=237
  75. Urlaub August 2008
    http://www.final-memory.org/?page_id=256
  76. Urlaub August 2009
    http://www.final-memory.org/?page_id=739
  77. Urlaub März 2011
    http://www.final-memory.org/?page_id=2083
  78. Kreatives Schreiben
    http://www.final-memory.org/?page_id=109
  79. ParadizeLib
    http://www.final-memory.org/?page_id=2250
  80. PGP
    http://www.final-memory.org/?page_id=17
  81. Spielekompatibilität Windows 7
    http://www.final-memory.org/?page_id=1559
  82. Log in
    http://www.final-memory.org/wp-login.php
  83. Entries feed
    http://www.final-memory.org/?feed=rss2
  84. Comments feed
    http://www.final-memory.org/?feed=comments-rss2
  85. Entries (RSS)
    http://www.final-memory.org/?feed=rss2
  86. Comments (RSS)
    http://www.final-memory.org/?feed=comments-rss2

Links - Internal (nofollow)

0:

Links - Outbound

47:
  1. SEGGER Embedded Studio
    https://www.segger.com/products/development-tools/embedded-studio/
  2. https://github.com/simonsunnyboy/SNES2DB9
    https://github.com/simonsunnyboy/SNES2DB9
  3. memtest86
    https://www.memtest86.com/
  4. 7-Zip
    https://www.7-zip.org/
  5. Daemon Tools Lite
    https://www.daemon-tools.cc/deu/home
  6. Notepad++
    https://notepad-plus-plus.org/downloads/
  7. LibreOffice
    https://de.libreoffice.org/
  8. Acrobat Reader
    https://get.adobe.com/de/reader
  9. CDBurnerXP
    https://cdburnerxp.se/de/home
  10. Steambox
    https://praxistipps.chip.de/steam-box-was-ist-das_20626
  11. Steam OS
    https://store.steampowered.com/steamos/
  12. https://dban.org/
    https://dban.org/
  13. Red Orchestra
    https://store.steampowered.com/app/1200/Red_Orchestra_Ostfront_4145/
  14. https://github.com/simonsunnyboy/stm32hal_bluepill
    https://github.com/simonsunnyboy/stm32hal_bluepill
  15. https://github.com/simonsunnyboy/bin2woz
    https://github.com/simonsunnyboy/bin2woz
  16. https://github.com/petersieg/arduino/tree/master/arduino_6502_apple1
    https://github.com/petersieg/arduino/tree/master/arduino_6502_apple1
  17. Atari Age
    http://www.atariage.com/
  18. Atari-Forum
    http://www.atari-forum.com/
  19. Atari-GFA-Forum
    http://atari.gfa.forum.free.fr/
  20. atari-home.de
    http://www.atari-home.de/
  21. Atarimania
    http://www.atarimania.com
  22. D-Bug
    http://dbug.atari.org/
  23. Dead Hackers Society
    http://dhs.nu/
  24. Paradize
    http://paradize.atari.org/
  25. ST Offline Tournament
    http://www.npoi.de/stot
  26. Lehrbergwerk Grube Roter Bär
    http://www.lehrbergwerk.de/
  27. Success Denied
    http://www.successdenied.com/
  28. USA erklärt
    http://usaerklaert.wordpress.com/
  29. YiGG
    http://www.yigg.de/
  30. LX’s Blog
    http://blog.siebelt.org/
  31. Martin Diedrich
    http://www.mdiedrich.de/
  32. PCX’s Blog
    http://pcxhb.blogspot.com/
  33. The Lonely Retro Coder
    http://retrocoder.over-blog.com/
  34. Thorn’s Blog
    http://thornstot.wordpress.com
  35. Tobias’ Schwalbenseite
    http://home.tu-clausthal.de/~mbtros/
  36. Encyclopedia Astronautica
    http://www.astronautix.com/
  37. Marssociety Deutschland
    http://www.marssociety.de/
  38. Spaceflight Now
    http://spaceflightnow.com/
  39. Blackcat Rockabilly Europe
    http://www.rockabilly.nl
  40. Jerry Lee Lewis
    http://www.jerryleelewis.com/
  41. Rockabilly Radio
    http://www.rockabillyradio.net/
  42. The Jerry Lee Lewis Start page
    http://www.jerryleelewis.nl/
  43. WordPress.org
    https://wordpress.org/
  44. XHTML
    http://validator.w3.org/check/referer
  45. CSS
    http://jigsaw.w3.org/css-validator/check/referer
  46. WordPress
    http://wordpress.org/
  47. a modfiied Fluid Blue theme
    http://srinig.com/wordpress/themes/fluid-blue/

Links - Outbound (nofollow)

0:

Keyword Cloud for Final-memory.org

frder acererstmalerstelltgithubarduino prototypich habelibraryknnenmchtekleinenwarrechnerunterhtte ichpeter2biryani masalagemachtmit derwreklassischenimansiavrapple 1hal librarywerdenwennzurvorfestplattenlschungaltenlibrary frsegger embedded studiokannbluedvdelektronik embedded systemscommentsarduinodieimmer nochderpaarampopenocddannansi c amp1 emulationsichluftsteamboxprototypich daszbgewrzmischungob10wurdeeinen95studiopill8221dennwolltewindows7zunchstunter windowsseggerauchoderembedded systemsallerdingswiederich damalsbenutzensteambox im eigenbausystemseinemurlaub4filetlliebercomments offwozmonalienwareeigentlichsiegembedded studioatarineuenstm32 halnbspnovember8220bluemussnoch eindawordpressmanapple 1 emulationmichmasala gewrzmischungkeineteilinstallierenmit einemvomim eigenbaujahren8220blue pill8221gutebootheutemehrasm software3ausacer pcentrieseigenbaunurhatteich diedebuggenichvon peter siegdendie 8220blue pill8221biryani masala gewrzmischungpmmeinenaufprojektcbeiwerdefr denhatviaesmir eineprobierteinstallationstartetemal wiedermitamstm32die 8220bluesodemdamalsvonsnes2db9mikrocontrollernbspnbspnbsp commentshalansi cseitkeinzumc amparbeitsrechnerfr dieeditorpcsnesembedded8elektronikgestartetmikrocontrollernbspnbspnbspsoftwarecaistprogrammehttesnes2db9 arduinogutacerdie stm32einer0blogwrdecategoryc64mit demdirekt6besseroffoctoberallesegger embeddedhatte ichpeter siegrechtbasisein paarwindows 7habe ich dannideasmsnes controllersnes2db9 arduino prototypder hal libraryein1schonhabe ichmirinstalliertdiesehabeaberdiesbiryanic99alsonachausprobiertdie installationzumindestdann nochemulationwieapplemeincontrollernochimmerdamitmeinedasich dannich erstmalalswirdmasalakomplettemir einohnesteamzuberder halmikrocontrollernbspnbspnbsp comments offnichtwindows 10sindsteambox imdazuwordpress 5elektronik embeddedstandfillbinarymalhomeversioneinevon peter

Longtail Keyword Density for Final-memory.org

KeywordsOccurences
segger embedded studio5
steambox im eigenbau4
habe ich dann4
die 8220blue pill82213
ansi c amp3
elektronik embedded systems3
mikrocontrollernbspnbspnbsp comments off3
snes2db9 arduino prototyp3
der hal library3
apple 1 emulation3
von peter sieg3
biryani masala gewrzmischung3
habe ich18
comments off10
windows 1010
8220blue pill82217
apple 17
fr die7
ein paar6
segger embedded6
ich dann6
mit dem6
hatte ich5
embedded systems5
snes controller5
windows 75
fr den5
hal library5
embedded studio5
mit einem5
acer pc4
unter windows4
der acer4
immer noch4
im eigenbau4
steambox im4
ich das4
ansi c4
die installation4
mir ein3
ich die3
biryani masala3
peter sieg3
von peter3
1 emulation3
die 8220blue3
wordpress 53
der hal3
library fr3
ich damals3
die stm323
ich habe3
ich erstmal3
mal wieder3
mit der3
htte ich3
stm32 hal3
dann noch3
mir eine3
c amp3
asm software3
elektronik embedded3
mikrocontrollernbspnbspnbsp comments3
snes2db9 arduino3
arduino prototyp3
noch ein3
masala gewrzmischung3
ich82
die54
mit47
der40
fr31
habe29
auf26
ein23
auch23
noch23
das22
den20
eine20
im19
nicht19
windows19
ist18
von17
dann16
aber16
014
mir13
mal13
113
als12
comments12
einem12
arduino12
dem12
embedded12
man12
nur11
zu11
controller11
category11
hatte11
atari11
einen10
off10
stm3210
zum9
apple9
unter9
bei9
es9
segger8
acer8
28
pm8
projekt8
schon8
da8
steambox8
kann8
pc7
37
library7
aus7
installation7
ber7
wozmon7
pill82217
snes2db97
immer7
8220blue7
wieder7
software7
wie7
mehr6
paar6
tl6
46
war6
einer6
htte6
muss6
oder6
sind6
gut6
hal6
knnen6
nach5
zumindest5
openocd5
wollte5
snes5
seit5
teil5
55
am5
asm5
steam5
file5
amp5
c5
so5
github5
erstmal5
studio5
diese5
systems5
dvd4
rechner4
hat4
vom4
version4
wurde4
damals4
eigenbau4
neuen4
jahren4
luft4
heute4
ohne4
alten4
wird4
lieber4
gute4
meinen4
installiert4
ansi4
avr4
editor4
64
wordpress4
binary4
debuggen4
sich4
zunchst4
damit4
74
home4
mich4
dies4
wenn4
werden3
alienware3
83
meine3
gestartet3
peter3
arbeitsrechner3
biryani3
93
november3
denn3
sieg3
nbsp3
fill3
masala3
alle3
103
zur3
emulation3
boot3
gewrzmischung3
eigentlich3
urlaub3
entries3
c643
stand3
mein3
elektronik3
c993
dazu3
komplette3
mchte3
benutzen3
blue3
via3
prototyp3
besser3
kein3
wre3
installieren3
zb3
ide3
october3
mikrocontrollernbspnbspnbsp3
kleinen3
programme3
allerdings3
wrde3
ob3
gemacht3
vor3
erstellt3
probierte3
startete3
keine3
klassischen3
festplattenlschung3
werde3
direkt3
ca3
ausprobiert3
basis3
also3
recht3
blog3

Final-memory.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Final-memory.org is a scam?

Websites with Similar Names

Final--four.net
403 Forbidden
Final-2000.com
403 Forbidden
Final-analytics.com
final-analytics.com
Final-answer.com
バイクショップ ファイナルアンサー | 東京・足立区で50cc〜250ccのスクーターならファイナルアンサーへ
Final-audio-design.com
final audio design | ファイナルオーディオデザイン
Final-checks.com
Final Checks

Recently Updated Websites

Lubimyczytac.pl 2 seconds ago.Katerinka-mua.ru 3 seconds ago.Kqz.org 3 seconds ago.Tearadio.com 4 seconds ago.Txbentre.edu.vn 4 seconds ago.Theconnectionpuzzle.net 5 seconds ago.Sewapickup.org 5 seconds ago.Clavorico.com 5 seconds ago.Scancainc.org 6 seconds ago.Myhgc.org 6 seconds ago.Piedmontbsa.org 6 seconds ago.Stadtfilter.ch 6 seconds ago.Wineloverhungerfighter.com 7 seconds ago.Manteno.com 7 seconds ago.Jadabait.net 7 seconds ago.Laplagedigitale.eu 8 seconds ago.Bashiointimo.com 9 seconds ago.Defenseexpertise.com 9 seconds ago.Bryansfitness.com 9 seconds ago.Piwal.com 9 seconds ago.Ckoegler.org 9 seconds ago.Windrunnerlihuan.com 10 seconds ago.Nefertitirising.com 10 seconds ago.Specialtymarketsplus.com 10 seconds ago.Sgmelitedesign.com 10 seconds ago.Rparsonsconstructionltd.com 11 seconds ago.Solarscreenllc.com 11 seconds ago.Centurylending.net 12 seconds ago.Turkopt.com 12 seconds ago.Pennyfm.com 13 seconds ago.