Find-a-bride.netFind-a-bride.net

Add a review Follow site

Find a Bride that Will Help Your Romantic Life

Safety: High trust score

Year Founded: 2019

Global Traffic Rank: 8,220

Estimated Worth: $1,134,000

Last updated:2020-12-11

Category: This site has not been categorized yet

Expand details Add category Claim this site

A mail order wife is a concept that is appreciated by many. Since we are the service that locates the best online foreign brides, we can be your friends in the process of finding a wife. Prepare to buy the services that are going to bring you an ideal woman

find-a-bride

Add a review Follow (0)

Domain summary

Domain label	find-a-bride
Domain extension	net
Domain registered:	2019-12-19
Domain updated:	2019-12-19
Domain expires:	2020-12-19
Global Traffic Rank	8,220
Statvoo Rating	B
Trust Score	High trust score
Estimated worth	$1,134,000
Estimated daily income	$1,575
Estimated monthly income	$47,906

Rank summary

How is find-a-bride.net ranked relative to other sites:

Percentage of visits to find-a-bride.net from a search engine:

Frequently Asked Questions (FAQ)

Q: When was Find-a-bride.net registered?

A: Find-a-bride.net was registered 1 year, 2 months, 1 week, 1 day, 32 minutes, 45 seconds ago on Thursday, December 19, 2019.

Q: When was the WHOIS for Find-a-bride.net last updated?

A: The WHOIS entry was last updated 1 year, 2 months, 1 week, 1 day, 32 minutes, 45 seconds ago on Thursday, December 19, 2019.

Q: What are Find-a-bride.net's nameservers?

A: DNS for Find-a-bride.net is provided by the following nameservers:

bowen.ns.cloudflare.com
cass.ns.cloudflare.com

Q: Who is the registrar for the Find-a-bride.net domain?

A: The domain has been registered at PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM.

Q: What is the traffic rank for Find-a-bride.net?

A: Find-a-bride.net ranks 8,220 globally on Alexa. Find-a-bride.net has a High trust score, and a Statvoo Rank of B.

Q: How many people visit Find-a-bride.net each day?

A: Find-a-bride.net receives approximately 131,216 visitors and 787,296 page impressions per day.

Q: What IP address does Find-a-bride.net resolve to?

A: Find-a-bride.net resolves to the IPv4 address 172.67.209.31.

Q: In what country are Find-a-bride.net servers located in?

A: Find-a-bride.net has servers located in the United States.

Q: What webserver software does Find-a-bride.net use?

A: Find-a-bride.net is powered by CloudFlare webserver.

Q: Who hosts Find-a-bride.net?

A: Find-a-bride.net is hosted by T-Mobile USA, Inc. in United States.

Q: How much is Find-a-bride.net worth?

A: Find-a-bride.net has an estimated worth of $1,134,000. An average daily income of approximately $1,575, which is roughly $47,906 per month.

Find-a-bride.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Find-a-bride.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Find-a-bride.net

H1 Headings

1 :

This Is How You Find a Bride with Find-a-bride.net

H2 Headings

4 :

Find Bride: Approach the Ladies without Fear
This Is How You Can Find a Bride in the Contemporary World
Mail Order Brides and Plenty of Positive Reviews
A Mail Order Bride that Will Enchant You Right Away

H3 Headings

4 :

The Best Mail Order Brides of 2020
Top 5 Mail Order Brides Websites
What Is the Way to Get Mail Order Bride?
Does the Mail Bride Service Work Properly?

H4 Headings

5 :

BeHappy2Day
AllTverLadies
OneWife
PerfectMatch2Day
AsianSingles2Day

H5 Headings

0 :

H6 Headings

3 :

About Us
Mail Order Brides:
Follow Us

Total IFRAMEs

0 :

Total Images

36 :

Google Adsense

Not Applicable

Google Analytics

UA-158382643-2

Links - Internal

22:

Show 17 more items

Links - Internal (nofollow)

Show 1 more items

Links - Outbound

Links - Outbound (nofollow)

Keyword Cloud for Find-a-bride.net

wifelifespeed500 autoplayfalse loopfalsemaytheirwebsiteloopfalse rewindfalsefull review visitvietnameseorder brideaxishorizontal gutter0 edgepadding0review visitdating sitesshouldtheyrewindfalse autoheightfalse items1heretheremathfloormathrandomblockread fullrate rating bestactuallyitems1 lazyloadfalse touchtruelovereadbridessensemodecarousel axishorizontalwouldyou shouldwivesgutter0 edgepadding0men0pastslidebypage controlsfalse navtrueedgepadding0 fixedwidthfalsefindabridenetautoplayfalse loopfalsesearchordergoinghave beentouchtrue mousedragfalsenonespecificeven ifaroundrate ratingmorecontrolsfalse navtrue arrowkeysfalseanyreply rate ratingcomematchallfind a bridegetbeencommononlytouchtrue mousedragfalse setintervalfunctionvarmail order bridemodecarousel axishorizontal gutter0onlinefull reviewreply ratemodecarouselwe haverating bestmousedragfalse setintervalfunctionvarcomesgoodonline replyacrossautoplayfalse loopfalse rewindfalsedo notvar sliderfixedwidthfalse slidebypage controlsfalsedonttimecontrolsfalsehelpgutter0worldsamedatingmail bridecaseotherloopfalseladyaxishorizontalnavtrue arrowkeysfalse speed500online reply rateslidebypagewaitinglazyloadfalse touchtrue mousedragfalseorder bridesdoampedgepadding0 fixedwidthfalse slidebypagerelationshipssliderpeopleif youfixedwidthfalse slidebypagereplygirlsrewindfalse autoheightfalsegutter0 edgepadding0 fixedwidthfalselazyloadfalse touchtruenotrightfixedwidthfalseservicegirls online replylookneverfindweyou canhelp youukraineyou havevarwomenif you havevisit websiteitems1relationshipnavtrue arrowkeysfalseknowwaysitesyouautoheightfalse items1yourthemtrysitearrowkeysfalse speed500 autoplayfalsetouchtrueratingfunctionhasexpertsspeed500 autoplayfalsefindingvisitcherishmail order bridesread full reviewoneloopfalse rewindfalse autoheightfalseedgepadding0axishorizontal gutter0autoplayfalsecontrolsfalse navtrueevenreasoneven if youcommunicationarrowkeysfalse speed500setintervalfunctionvarcanbrideautoheightfalsebestadventurerewindfalsegivestartromanticprocessnomailperfectslidebypage controlsfalseservice weanotherifnowaround the worldsomeoneratemeetarrowkeysfalsereview visit websitespeed500fullwithoutlikegirls onlinewe knoweuropeanladiesusmousedragfalseoptionsmail orderitems1 lazyloadfalseidealyou dontcannotnavtrueourlazyloadfalsecoupleshavereviewwomanmakeautoheightfalse items1 lazyloadfalse

Longtail Keyword Density for Find-a-bride.net

Keywords	Occurences
mail order brides	9
find a bride	7
rewindfalse autoheightfalse items1	5
review visit website	5
full review visit	5
read full review	5
reply rate rating	5
online reply rate	5
girls online reply	5
touchtrue mousedragfalse setintervalfunctionvar	5
lazyloadfalse touchtrue mousedragfalse	5
items1 lazyloadfalse touchtrue	5
autoheightfalse items1 lazyloadfalse	5
loopfalse rewindfalse autoheightfalse	5
fixedwidthfalse slidebypage controlsfalse	5
modecarousel axishorizontal gutter0	5
axishorizontal gutter0 edgepadding0	5
gutter0 edgepadding0 fixedwidthfalse	5
autoplayfalse loopfalse rewindfalse	5
edgepadding0 fixedwidthfalse slidebypage	5
slidebypage controlsfalse navtrue	5
controlsfalse navtrue arrowkeysfalse	5
navtrue arrowkeysfalse speed500	5
arrowkeysfalse speed500 autoplayfalse	5
speed500 autoplayfalse loopfalse	5
rate rating best	4
mail order bride	4
around the world	3
even if you	3
if you have	3
mail order	16
you have	9
order brides	9
you can	8
if you	8
lazyloadfalse touchtrue	5
we have	5
visit website	5
review visit	5
full review	5
read full	5
rate rating	5
reply rate	5
girls online	5
mousedragfalse setintervalfunctionvar	5
touchtrue mousedragfalse	5
online reply	5
items1 lazyloadfalse	5
slidebypage controlsfalse	5
axishorizontal gutter0	5
autoheightfalse items1	5
gutter0 edgepadding0	5
edgepadding0 fixedwidthfalse	5
fixedwidthfalse slidebypage	5
controlsfalse navtrue	5
var slider	5
navtrue arrowkeysfalse	5
arrowkeysfalse speed500	5
speed500 autoplayfalse	5
autoplayfalse loopfalse	5
loopfalse rewindfalse	5
rewindfalse autoheightfalse	5
modecarousel axishorizontal	5
we know	4
have been	4
rating best	4
order bride	4
you dont	3
help you	3
service we	3
mail bride	3
dating sites	3
do not	3
you should	3
even if	3
you	62
we	35
have	24
brides	23
mail	19
order	18
bride	18
var	18
dating	14
find	14
they	13
your	12
their	12
girls	12
not	12
can	10
world	9
amp	9
men	9
if	8
all	8
best	7
there	7
service	7
website	7
find-a-bridenet	6
review	6
rate	6
good	6
love	6
know	6
more	6
been	6
time	6
women	6
them	6
online	6
visit	5
start	5
full	5
read	5
0	5
way	5
another	5
lady	5
help	5
people	5
rating	5
reply	5
ladies	5
mathfloormathrandom	5
navtrue	5
never	5
slider	5
modecarousel	5
axishorizontal	5
gutter0	5
function	5
us	5
edgepadding0	5
fixedwidthfalse	5
slidebypage	5
controlsfalse	5
arrowkeysfalse	5
speed500	5
couples	5
autoplayfalse	5
loopfalse	5
rewindfalse	5
autoheightfalse	5
items1	5
lazyloadfalse	5
touchtrue	5
mousedragfalse	5
setintervalfunctionvar	5
none	4
same	4
meet	4
no	4
woman	4
life	4
around	4
relationships	4
block	4
our	4
going	4
come	4
experts	4
like	4
sites	4
cannot	4
try	4
make	4
search	4
only	4
even	4
romantic	4
do	4
right	3
any	3
here	3
should	3
vietnamese	3
reason	3
may	3
ukraine	3
common	3
other	3
communication	3
look	3
has	3
would	3
comes	3
past	3
relationship	3
european	3
sense	3
cherish	3
options	3
get	3
one	3
site	3
process	3
without	3
someone	3
actually	3
adventure	3
case	3
now	3
across	3
give	3
perfect	3
match	3
wives	3
waiting	3
ideal	3
wife	3
dont	3
specific	3
finding	3

Who hosts Find-a-bride.net?

Find-a-bride.net Hosting Provider Information

Hosted IP Address:	172.67.209.31
Hosted Hostname:	172.67.209.31
Service Provider:	T-Mobile USA, Inc.
Hosted Country:	US
Location Latitude:	37.751
Location Longitude:	-97.822
Webserver Software:	CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name

Percentage

DoD Network Information Center

15.4872%

GoDaddy.com, LLC

9.2224%

Namecheap, Inc.

3.8991%

Google Inc.

2.8555%

Confluence Networks Inc

2.6870%

Amazon.com, Inc.

1.9936%

Merit Network Inc.

1.8570%

1&1 Internet AG

1.8247%

TOT Public Company Limited

1.6908%

Squarespace, Inc.

1.5625%

T-Mobile USA, Inc.

1.2248%

HTTP Header Analysis for Find-a-bride.net

Http-Version:	1.1
Status-Code:	200
Status:	200 OK
Date:	Fri, 11 Dec 2020 02:22:00 GMT
Content-Type:	text/html; charset=UTF-8
Transfer-Encoding:	chunked
Connection:	keep-alive
X-Powered-By:	PHP/7.0.31
X-Pingback:	https://find-a-bride.net/xmlrpc.php
Link:	; rel="https://api.w.org/", ; rel=shortlink
Vary:	Accept-Encoding
Cache-Control:	max-age=300
Expires:	Fri, 11 Dec 2020 02:27:00 GMT
CF-Cache-Status:	DYNAMIC
cf-request-id:	06f133fe2d0000ce17e999b000000001
Expect-CT:	max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To:	{"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=VbiQUtIXM/Pwv0pJHirLEuyqxI7G+WE1oMQy4m2RNVYssJdZd1X7chdT9my+HHzXdeNUub9lXtNNJnFvH653UG2Idv45W4pqGFZ7eDifGRY3"}],"group":"cf-nel","max_age":604800}
NEL:	{"report_to":"cf-nel","max_age":604800}
Server:	cloudflare
CF-RAY:	5ffbbc437818ce17-LHR
Content-Encoding:	gzip

Find-a-bride.net Domain Nameserver Information

Host	IP Address	Country
bowen.ns.cloudflare.com	162.159.44.83
cass.ns.cloudflare.com	108.162.192.81

Need to find out who hosts Find-a-bride.net?

Domain Registration (WhoIs) information for Find-a-bride.net

 Domain Name: FIND-A-BRIDE.NET
Registry Domain ID: 2469050977_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2020-02-18T02:16:52Z
Creation Date: 2019-12-19T11:04:55Z
Registrar Registration Expiration Date: 2020-12-19T11:04:55Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Igor
Registrant Organization:
Registrant Street: Parhomenko
Registrant City: Kiev
Registrant State/Province: Kiev
Registrant Postal Code: 02095
Registrant Country: UA
Registrant Phone: +380.972810288
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
 Admin ID: Not Available From Registry
Admin Name: Igor
Admin Organization:
Admin Street: Parhomenko
Admin City: Kiev
Admin State/Province: Kiev
Admin Postal Code: 02095
Admin Country: UA
Admin Phone: +380.972810288
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
 Tech ID: Not Available From Registry
Tech Name: Igor
Tech Organization:
Tech Street: Parhomenko
Tech City: Kiev
Tech State/Province: Kiev
Tech Postal Code: 02095
Tech Country: UA
Tech Phone: +380.972810288
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
 Server: bowen.ns.cloudflare.com
Name Server: cass.ns.cloudflare.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: Login to show email
 Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-12-11T02:22:00Z