Find a Bride that Will Help Your Romantic Life

Safety: High trust score
Year Founded: 2019
Global Traffic Rank: 8,220
Estimated Worth: $1,134,000
Last updated:2020-12-11
Category: This site has not been categorized yet

A mail order wife is a concept that is appreciated by many. Since we are the service that locates the best online foreign brides, we can be your friends in the process of finding a wife. Prepare to buy the services that are going to bring you an ideal woman


Domain summary

Domain label
find-a-bride
Domain extension
net
Domain registered:
2019-12-19
Domain updated:
2019-12-19
Domain expires:
2020-12-19
Global Traffic Rank
8,220
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$1,134,000
Estimated daily income
$1,575
Estimated monthly income
$47,906

Rank summary

How is find-a-bride.net ranked relative to other sites:

Percentage of visits to find-a-bride.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Find-a-bride.net registered?
A: Find-a-bride.net was registered 1 year, 2 months, 1 week, 1 day, 32 minutes, 45 seconds ago on Thursday, December 19, 2019.
Q: When was the WHOIS for Find-a-bride.net last updated?
A: The WHOIS entry was last updated 1 year, 2 months, 1 week, 1 day, 32 minutes, 45 seconds ago on Thursday, December 19, 2019.
Q: What are Find-a-bride.net's nameservers?
A: DNS for Find-a-bride.net is provided by the following nameservers:
  • bowen.ns.cloudflare.com
  • cass.ns.cloudflare.com
Q: Who is the registrar for the Find-a-bride.net domain?
A: The domain has been registered at PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM.
Q: What is the traffic rank for Find-a-bride.net?
A: Find-a-bride.net ranks 8,220 globally on Alexa. Find-a-bride.net has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Find-a-bride.net each day?
A: Find-a-bride.net receives approximately 131,216 visitors and 787,296 page impressions per day.
Q: What IP address does Find-a-bride.net resolve to?
A: Find-a-bride.net resolves to the IPv4 address 172.67.209.31.
Q: In what country are Find-a-bride.net servers located in?
A: Find-a-bride.net has servers located in the United States.
Q: What webserver software does Find-a-bride.net use?
A: Find-a-bride.net is powered by CloudFlare webserver.
Q: Who hosts Find-a-bride.net?
A: Find-a-bride.net is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Find-a-bride.net worth?
A: Find-a-bride.net has an estimated worth of $1,134,000. An average daily income of approximately $1,575, which is roughly $47,906 per month.

Find-a-bride.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Find-a-bride.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Find-a-bride.net

H1 Headings

1 :
  1. This Is How You Find a Bride with Find-a-bride.net

H2 Headings

4 :
  1. Find Bride: Approach the Ladies without Fear
  2. This Is How You Can Find a Bride in the Contemporary World
  3. Mail Order Brides and Plenty of Positive Reviews
  4. A Mail Order Bride that Will Enchant You Right Away

H3 Headings

4 :
  1. The Best Mail Order Brides of 2020
  2. Top 5 Mail Order Brides Websites
  3. What Is the Way to Get Mail Order Bride?
  4. Does the Mail Bride Service Work Properly?

H4 Headings

5 :
  1. BeHappy2Day
  2. AllTverLadies
  3. OneWife
  4. PerfectMatch2Day
  5. AsianSingles2Day

H5 Headings

0 :

H6 Headings

3 :
  1. About Us
  2. Mail Order Brides:
  3. Follow Us

Total IFRAMEs

0 :

Total Images

36 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-158382643-2

Links - Internal

22:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Find-a-bride.net

wifelifespeed500 autoplayfalse loopfalsemaytheirwebsiteloopfalse rewindfalsefull review visitvietnameseorder brideaxishorizontal gutter0 edgepadding0review visitdating sitesshouldtheyrewindfalse autoheightfalse items1heretheremathfloormathrandomblockread fullrate rating bestactuallyitems1 lazyloadfalse touchtruelovereadbridessensemodecarousel axishorizontalwouldyou shouldwivesgutter0 edgepadding0men0pastslidebypage controlsfalse navtrueedgepadding0 fixedwidthfalsefindabridenetautoplayfalse loopfalsesearchordergoinghave beentouchtrue mousedragfalsenonespecificeven ifaroundrate ratingmorecontrolsfalse navtrue arrowkeysfalseanyreply rate ratingcomematchallfind a bridegetbeencommononlytouchtrue mousedragfalse setintervalfunctionvarmail order bridemodecarousel axishorizontal gutter0onlinefull reviewreply ratemodecarouselwe haverating bestmousedragfalse setintervalfunctionvarcomesgoodonline replyacrossautoplayfalse loopfalse rewindfalsedo notvar sliderfixedwidthfalse slidebypage controlsfalsedonttimecontrolsfalsehelpgutter0worldsamedatingmail bridecaseotherloopfalseladyaxishorizontalnavtrue arrowkeysfalse speed500online reply rateslidebypagewaitinglazyloadfalse touchtrue mousedragfalseorder bridesdoampedgepadding0 fixedwidthfalse slidebypagerelationshipssliderpeopleif youfixedwidthfalse slidebypagereplygirlsrewindfalse autoheightfalsegutter0 edgepadding0 fixedwidthfalselazyloadfalse touchtruenotrightfixedwidthfalseservicegirls online replylookneverfindweyou canhelp youukraineyou havevarwomenif you havevisit websiteitems1relationshipnavtrue arrowkeysfalseknowwaysitesyouautoheightfalse items1yourthemtrysitearrowkeysfalse speed500 autoplayfalsetouchtrueratingfunctionhasexpertsspeed500 autoplayfalsefindingvisitcherishmail order bridesread full reviewoneloopfalse rewindfalse autoheightfalseedgepadding0axishorizontal gutter0autoplayfalsecontrolsfalse navtrueevenreasoneven if youcommunicationarrowkeysfalse speed500setintervalfunctionvarcanbrideautoheightfalsebestadventurerewindfalsegivestartromanticprocessnomailperfectslidebypage controlsfalseservice weanotherifnowaround the worldsomeoneratemeetarrowkeysfalsereview visit websitespeed500fullwithoutlikegirls onlinewe knoweuropeanladiesusmousedragfalseoptionsmail orderitems1 lazyloadfalseidealyou dontcannotnavtrueourlazyloadfalsecoupleshavereviewwomanmakeautoheightfalse items1 lazyloadfalse

Longtail Keyword Density for Find-a-bride.net

KeywordsOccurences
mail order brides9
find a bride7
rewindfalse autoheightfalse items15
review visit website5
full review visit5
read full review5
reply rate rating5
online reply rate5
girls online reply5
touchtrue mousedragfalse setintervalfunctionvar5
lazyloadfalse touchtrue mousedragfalse5
items1 lazyloadfalse touchtrue5
autoheightfalse items1 lazyloadfalse5
loopfalse rewindfalse autoheightfalse5
fixedwidthfalse slidebypage controlsfalse5
modecarousel axishorizontal gutter05
axishorizontal gutter0 edgepadding05
gutter0 edgepadding0 fixedwidthfalse5
autoplayfalse loopfalse rewindfalse5
edgepadding0 fixedwidthfalse slidebypage5
slidebypage controlsfalse navtrue5
controlsfalse navtrue arrowkeysfalse5
navtrue arrowkeysfalse speed5005
arrowkeysfalse speed500 autoplayfalse5
speed500 autoplayfalse loopfalse5
rate rating best4
mail order bride4
around the world3
even if you3
if you have3
mail order16
you have9
order brides9
you can8
if you8
lazyloadfalse touchtrue5
we have5
visit website5
review visit5
full review5
read full5
rate rating5
reply rate5
girls online5
mousedragfalse setintervalfunctionvar5
touchtrue mousedragfalse5
online reply5
items1 lazyloadfalse5
slidebypage controlsfalse5
axishorizontal gutter05
autoheightfalse items15
gutter0 edgepadding05
edgepadding0 fixedwidthfalse5
fixedwidthfalse slidebypage5
controlsfalse navtrue5
var slider5
navtrue arrowkeysfalse5
arrowkeysfalse speed5005
speed500 autoplayfalse5
autoplayfalse loopfalse5
loopfalse rewindfalse5
rewindfalse autoheightfalse5
modecarousel axishorizontal5
we know4
have been4
rating best4
order bride4
you dont3
help you3
service we3
mail bride3
dating sites3
do not3
you should3
even if3
you62
we35
have24
brides23
mail19
order18
bride18
var18
dating14
find14
they13
your12
their12
girls12
not12
can10
world9
amp9
men9
if8
all8
best7
there7
service7
website7
find-a-bridenet6
review6
rate6
good6
love6
know6
more6
been6
time6
women6
them6
online6
visit5
start5
full5
read5
05
way5
another5
lady5
help5
people5
rating5
reply5
ladies5
mathfloormathrandom5
navtrue5
never5
slider5
modecarousel5
axishorizontal5
gutter05
function5
us5
edgepadding05
fixedwidthfalse5
slidebypage5
controlsfalse5
arrowkeysfalse5
speed5005
couples5
autoplayfalse5
loopfalse5
rewindfalse5
autoheightfalse5
items15
lazyloadfalse5
touchtrue5
mousedragfalse5
setintervalfunctionvar5
none4
same4
meet4
no4
woman4
life4
around4
relationships4
block4
our4
going4
come4
experts4
like4
sites4
cannot4
try4
make4
search4
only4
even4
romantic4
do4
right3
any3
here3
should3
vietnamese3
reason3
may3
ukraine3
common3
other3
communication3
look3
has3
would3
comes3
past3
relationship3
european3
sense3
cherish3
options3
get3
one3
site3
process3
without3
someone3
actually3
adventure3
case3
now3
across3
give3
perfect3
match3
wives3
waiting3
ideal3
wife3
dont3
specific3
finding3

Who hosts Find-a-bride.net?

Find-a-bride.net Hosting Provider Information

Hosted IP Address:172.67.209.31
Hosted Hostname:172.67.209.31
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
T-Mobile USA, Inc.
1.2248%

HTTP Header Analysis for Find-a-bride.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 11 Dec 2020 02:22:00 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/7.0.31
X-Pingback: https://find-a-bride.net/xmlrpc.php
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding
Cache-Control: max-age=300
Expires: Fri, 11 Dec 2020 02:27:00 GMT
CF-Cache-Status: DYNAMIC
cf-request-id: 06f133fe2d0000ce17e999b000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=VbiQUtIXM/Pwv0pJHirLEuyqxI7G+WE1oMQy4m2RNVYssJdZd1X7chdT9my+HHzXdeNUub9lXtNNJnFvH653UG2Idv45W4pqGFZ7eDifGRY3"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5ffbbc437818ce17-LHR
Content-Encoding: gzip

Find-a-bride.net Domain Nameserver Information

HostIP AddressCountry
bowen.ns.cloudflare.com 162.159.44.83
cass.ns.cloudflare.com 108.162.192.81


Need to find out who hosts Find-a-bride.net?


Domain Registration (WhoIs) information for Find-a-bride.net

 Domain Name: FIND-A-BRIDE.NET
Registry Domain ID: 2469050977_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2020-02-18T02:16:52Z
Creation Date: 2019-12-19T11:04:55Z
Registrar Registration Expiration Date: 2020-12-19T11:04:55Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Igor
Registrant Organization:
Registrant Street: Parhomenko
Registrant City: Kiev
Registrant State/Province: Kiev
Registrant Postal Code: 02095
Registrant Country: UA
Registrant Phone: +380.972810288
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: Igor
Admin Organization:
Admin Street: Parhomenko
Admin City: Kiev
Admin State/Province: Kiev
Admin Postal Code: 02095
Admin Country: UA
Admin Phone: +380.972810288
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: Igor
Tech Organization:
Tech Street: Parhomenko
Tech City: Kiev
Tech State/Province: Kiev
Tech Postal Code: 02095
Tech Country: UA
Tech Phone: +380.972810288
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: bowen.ns.cloudflare.com
Name Server: cass.ns.cloudflare.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-12-11T02:22:00Z

Websites with Similar Names

Recently Updated Websites

12handscreations.com (3 seconds ago.)Yanakestetigi.com (4 seconds ago.)Nasia.info (4 seconds ago.)Notekook.com (4 seconds ago.)Pictopdf.org (5 seconds ago.)Appliance-industry.com (6 seconds ago.)Polarify.com (7 seconds ago.)Mdbarcelona.com (9 seconds ago.)Meaganhalley.com (10 seconds ago.)Composttumbler.co (10 seconds ago.)Ritualboards.com (10 seconds ago.)Vcurse.ru (10 seconds ago.)Conleycarwash.net (10 seconds ago.)Blackbrookcollective.com (12 seconds ago.)Tmsappnow.com (13 seconds ago.)Royalcityambassadors.com (14 seconds ago.)Hugomaggi.com (14 seconds ago.)Mylifebloom.com (14 seconds ago.)Amenagementfourgons.com (16 seconds ago.)Sbjctv.agency (16 seconds ago.)Teatronuovitalenti.com (17 seconds ago.)Aldingerwealth.com (18 seconds ago.)L5developments.com (18 seconds ago.)Inspectionflow.com (19 seconds ago.)Robotrek24.ru (20 seconds ago.)Siyahev.com (22 seconds ago.)Genealogie-bilddatenbank.com (22 seconds ago.)Vintagechopshop.com (26 seconds ago.)Liensysgov.com (28 seconds ago.)Aktifbola.org (28 seconds ago.)

Recently Searched Keywords

情報 (9 seconds ago.)next set (17 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (24 seconds ago.)benestyle hawaii (24 seconds ago.)东方神起 runaway 在线下载试听 (24 seconds ago.)it isn’t always eazi being breezy. (33 seconds ago.)doge 2048 (34 seconds ago.)最新加勒比 (36 seconds ago.)транссексуалы (84) (37 seconds ago.)7 800 775-57-36 (38 seconds ago.)16:14 الرقص العربي المصري - شارموتا - أنبوب الإباحية الحرة - mp4 إباحية، سكس سكس عربي (39 seconds ago.)16:14 الرقص العربي المصري - شارموتا - أنبوب الإباحية الحرة - mp4 إباحية، سكس سكس عربي (44 seconds ago.)31 march (59 seconds ago.)virtual servers (1 minute 5 seconds ago.)pneumatic hose fitting (1 minute 11 seconds ago.)ifspweb logo (1 minute 12 seconds ago.)facebook-f twitter (1 minute 15 seconds ago.)downlo (1 minute 18 seconds ago.)16:50 femdom clamps clothespins and a crop (1 minute 20 seconds ago.)��װ��� (1 minute 23 seconds ago.)business law (1 minute 23 seconds ago.)16:14 الرقص العربي المصري - شارموتا - أنبوب الإباحية الحرة - mp4 إباحية، سكس سكس عربي (1 minute 28 seconds ago.)16:14 الرقص العربي المصري - شارموتا - أنبوب الإباحية الحرة - mp4 إباحية، سكس سكس عربي (1 minute 31 seconds ago.)22:30 academica - varzim maçı canlı izle 23 kasım 2020 (1 minute 33 seconds ago.)gameface season 3 (1 minute 37 seconds ago.)danseuse  (1 minute 38 seconds ago.)quarterly earnings (1 minute 41 seconds ago.)situs resmi (1 minute 45 seconds ago.)aaa foundation for traffic safety (1 minute 48 seconds ago.)football news (1 minute 49 seconds ago.)