ファインテック日本 | Finetech

Safety: Low trust score
Year Founded: 2014
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-28
Category: This site has not been categorized yet


Domain summary

Domain label
finetech-nippon
Domain extension
co.jp
Domain registered:
2014-07-22
Domain updated:
2020-08-01
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is finetech-nippon.co.jp ranked relative to other sites:

Percentage of visits to finetech-nippon.co.jp from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Finetech-nippon.co.jp registered?
A: Finetech-nippon.co.jp was registered 6 years, 6 months, 4 days, 6 hours, 37 minutes, 18 seconds ago on Tuesday, July 22, 2014.
Q: When was the WHOIS for Finetech-nippon.co.jp last updated?
A: The WHOIS entry was last updated 5 months, 3 weeks, 4 days, 6 hours, 37 minutes, 18 seconds ago on Saturday, August 1, 2020.
Q: What are Finetech-nippon.co.jp's nameservers?
A: DNS for Finetech-nippon.co.jp is provided by the following nameservers:
  • ns1.value-domain.com
  • ns2.value-domain.com
  • ns3.value-domain.com
  • ns4.value-domain.com
  • ns5.value-domain.com
Q: Who is the registrar for the Finetech-nippon.co.jp domain?
A: The domain has been registered at Japan Registry Services.
Q: What is the traffic rank for Finetech-nippon.co.jp?
A: Finetech-nippon.co.jp has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Finetech-nippon.co.jp each day?
A: Finetech-nippon.co.jp receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Finetech-nippon.co.jp resolve to?
A: Finetech-nippon.co.jp resolves to the IPv4 address 78.46.146.172.
Q: In what country are Finetech-nippon.co.jp servers located in?
A: Finetech-nippon.co.jp has servers located in the Germany.
Q: What webserver software does Finetech-nippon.co.jp use?
A: Finetech-nippon.co.jp is powered by Apache webserver.
Q: Who hosts Finetech-nippon.co.jp?
A: Finetech-nippon.co.jp is hosted by Hetzner Online GmbH in Germany.
Q: How much is Finetech-nippon.co.jp worth?
A: Finetech-nippon.co.jp has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Finetech-nippon.co.jp Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Finetech-nippon.co.jp Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Finetech-nippon.co.jp

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

5 :
  1. 試作研究開発用途
  2. 高歩留り製造
  3. 高品質リワーク
  4. 最新のニュース
  5. イベント

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-464002-1

Links - Internal

60:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Finetech-nippon.co.jp

finext 6003finextfinext 6003finext 5205fineplacerpico mafineplacerblogimprintprivacy policyinformation requirementsservicefemtoblufineplacer pico mafineplacerfemtoblufineplacer corefineplacer picopolicyinformation requirementsservicemafineplacer lambdafemtoblufineplacer picocorefineplacer pico rs2fineplacer femtoblufineplacer corefineplacer5205fineplacer femto 2fineplacer5205fineplacer femtomafineplacer lambda 2fineplacerrs6003finext 5205fineplacer femtolambda 2fineplacerpolicyinformation requirementsservice finetechfemto 2fineplacer femtoblufineplacerlambda2fineplacer sigmafineplacer femto16003finext 5205fineplacerpico rs blogimprintprivacymafineplacerpico mafineplacer lambdafemto 2fineplacerrequirementsservicerequirementsservice finetechblogimprintprivacy policyinformation02fineplacer sigmafineplacerfinextpolicyinformationblogimprintprivacypicopico rs5205fineplacersigmafineplacer femtofemtoblufineplacer corefineplacer2fineplacer femtoblufineplacerlambda 2fineplacer sigmafineplacerfemtojancorefineplacer picors blogimprintprivacy policyinformation6003finextphotonicssigmafineplacer femto 2fineplacerfinetechcorefineplacerrs blogimprintprivacy2fineplacer femtoblufineplacer pico2fineplacerfemtoblufineplacersigmafineplacerchina

Longtail Keyword Density for Finetech-nippon.co.jp

KeywordsOccurences
femto 2fineplacer femtoblufineplacer6
finext 6003finext 5205fineplacer3
sigmafineplacer femto 2fineplacer3
-blogimprintprivacy policyinformation requirementsservice3
rs -blogimprintprivacy policyinformation3
pico rs -blogimprintprivacy3
corefineplacer pico rs3
femtoblufineplacer corefineplacer pico3
2fineplacer femtoblufineplacer corefineplacer3
2fineplacer sigmafineplacer femto3
6003finext 5205fineplacer femto3
lambda 2fineplacer sigmafineplacer3
mafineplacer lambda 2fineplacer3
pico mafineplacer lambda3
femtoblufineplacer pico mafineplacer3
2fineplacer femtoblufineplacer pico3
5205fineplacer femto 2fineplacer3
policyinformation requirementsservice finetech3
femto 2fineplacer6
2fineplacer femtoblufineplacer6
finext 6003finext3
femtoblufineplacer corefineplacer3
policyinformation requirementsservice3
-blogimprintprivacy policyinformation3
rs -blogimprintprivacy3
pico rs3
corefineplacer pico3
2fineplacer sigmafineplacer3
sigmafineplacer femto3
6003finext 5205fineplacer3
lambda 2fineplacer3
mafineplacer lambda3
pico mafineplacer3
femtoblufineplacer pico3
5205fineplacer femto3
requirementsservice finetech3
2fineplacer9
femto6
femtoblufineplacer6
pico6
finetech5
photonics4
04
finext3
policyinformation3
jan3
china3
requirementsservice3
corefineplacer3
-blogimprintprivacy3
rs3
6003finext3
sigmafineplacer3
lambda3
mafineplacer3
5205fineplacer3
13

Who hosts Finetech-nippon.co.jp?

Finetech-nippon.co.jp Hosting Provider Information

Hosted IP Address:78.46.146.172
Hosted Hostname:dedi5022.your-server.de
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Hetzner Online GmbH
0.5334%

HTTP Header Analysis for Finetech-nippon.co.jp

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 28 Nov 2020 11:34:20 GMT
Server: Apache
Content-Language: ja
Content-Encoding: gzip
Vary: Accept-Encoding
Upgrade: h2
Connection: Upgrade
Content-length: 9213
Cache-Control: max-age=0
Expires: Sat, 28 Nov 2020 11:34:20 GMT
X-UA-Compatible: IE=edge
X-Content-Type-Options: nosniff
Content-Type: text/html; charset=utf-8

Finetech-nippon.co.jp Domain Nameserver Information

HostIP AddressCountry
ns1.value-domain.com 54.95.235.193
ns2.value-domain.com 54.95.235.193
ns3.value-domain.com 13.113.233.0
ns4.value-domain.com 18.180.19.156
ns5.value-domain.com 18.182.161.82


Need to find out who hosts Finetech-nippon.co.jp?


Domain Registration (WhoIs) information for Finetech-nippon.co.jp

 [ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]

Domain Information:
a. [Domain Name] FINETECH-NIPPON.CO.JP
g. [Organization] Finetech Nippon Co., Ltd.
l. [Organization Type] Corporation
m. [Administrative Contact] KI22437JP
n. [Technical Contact] KI22437JP
p. [Name Server] ns1.value-domain.com
p. [Name Server] ns2.value-domain.com
p. [Name Server] ns3.value-domain.com
p. [Name Server] ns4.value-domain.com
p. [Name Server] ns5.value-domain.com
s. [Signing Key]
[State] Connected (2021/07/31)
[Registered Date] 2014/07/22
[Connected Date] 2014/07/22
[Last Update] 2020/08/01 01:14:44 (JST)

[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]

Contact Information:
a. [JPNIC Handle] KI22437JP
c. [Last, First] IIDA, KOTARO
d. [E-Mail] Login to show email
[Organization] Finetech Nippon Co., Ltd.
l. [Division] Sales & Support Division
n. [Title]
o. [TEL] 050-3596-2084
p. [FAX]
y. [Reply Mail]
[Last Update] 2014/07/19 23:12:06 Login to show email

Websites with Similar Names

Finet-vino.cz
FINET s.r.o. - Maďarská vína | Maďarská vína
Finet.archi
Félicitations ! Votre domaine a bien été créé chez OVH !
Finet.pl
FiNet - Profesjonalne usługi informatyczne
Finetablecloths.com
European Art Design
Finetagusa.com
finetagusa.com

Recently Updated Websites

Yyvip9807.com (1 second ago.)Yyvip7092.com (2 seconds ago.)Yyvip7241.com (2 seconds ago.)Yyvip6850.com (3 seconds ago.)Zachdrivermedia.com (4 seconds ago.)Procomamerica.com (5 seconds ago.)Yyvip6690.com (5 seconds ago.)Yyvip7840.com (5 seconds ago.)Yyvip7569.com (6 seconds ago.)Yyvip9746.com (7 seconds ago.)Yyvip9950.com (7 seconds ago.)Yyvip5825.com (7 seconds ago.)Yyvip7661.com (8 seconds ago.)Yyvip7527.com (9 seconds ago.)Zentricadigital.com (9 seconds ago.)Yyvip7166.com (9 seconds ago.)Yyvip8576.com (10 seconds ago.)Yyvip5836.com (11 seconds ago.)2zgxp.club (11 seconds ago.)Yyvip6775.com (12 seconds ago.)Yyvip7183.com (12 seconds ago.)Yyvip6682.com (14 seconds ago.)Yyvip5674.com (14 seconds ago.)Yyvip7946.com (14 seconds ago.)Yyvip7235.com (16 seconds ago.)Yyvip8584.com (16 seconds ago.)Tvproposal.com (17 seconds ago.)Yyvip6843.com (18 seconds ago.)Yyvip9953.com (18 seconds ago.)Zgdkyw.com (19 seconds ago.)

Recently Searched Keywords

клей момент (1 second ago.)29.11.2016 (2 seconds ago.)страхование путешествий (2 seconds ago.)медицинская страховка для визы (3 seconds ago.)03s ease -o-transition (4 seconds ago.)для бетона и камня (5 seconds ago.)color 000000 -webkit-transition (7 seconds ago.)для паркета и деревянного пола (8 seconds ago.)маска для лица (9 seconds ago.)smart bands (9 seconds ago.)best place to order plants for delivery (9 seconds ago.)hqzone (11 seconds ago.)best place to order balloons for delivery (12 seconds ago.)뽀샤시 보정 (13 seconds ago.)idecorwala (14 seconds ago.)گیلکی (15 seconds ago.)idecoop (16 seconds ago.)chicken recipes (16 seconds ago.)yorkie (17 seconds ago.)idecorate (20 seconds ago.)清远 (21 seconds ago.)di ogni (22 seconds ago.)smart design and tech innovation (23 seconds ago.)royalcreampr (25 seconds ago.)up satta king (29 seconds ago.)rgs school dubai (29 seconds ago.)cards-container-wrap card-content-container (31 seconds ago.)schroeven bpg pozi verz.bolkop (31 seconds ago.)ورزش (33 seconds ago.)emlak otomobil slamiyet (33 seconds ago.)