|  Finya - Kostenloses Online-Dating
Low trust score  | 
Finya ist modernes, kostenloses Online-Dating. Jetzt anmelden und den Traumpartner finden! Website Information has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 8,384, a Majestic Rank of 989,024, a Domain Authority of 40% and is not listed in DMOZ. is hosted by PlusServer AG in Germany. has an IP Address of and a hostname of

The domain was registered 201 decades 8 years 9 months ago by , it was last modified 5 years 2 months 4 weeks ago and currently is set to expire 201 decades 8 years 9 months ago.

Whois information for

Full Whois Lookup for Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2014-09-26T10:37:44+02:00

Name: GW interactive Hostmaster
Organisation: GWI Media Technologies GmbH
Address: Moenckebergstr. 13
PostalCode: 20095
City: Hamburg
CountryCode: DE
Phone: +49-406008070
Fax: +49-406008070
Email: Login to show email

Name: GW interactive Hostmaster
Organisation: GWI Media Technologies GmbH
Address: Moenckebergstr. 13
PostalCode: 20095
City: Hamburg
CountryCode: DE
Phone: +49-406008070
Fax: +49-406008070
Email: Login to show email

Who hosts Web Server Information

Hosted IP Address:
Service Provider:PlusServer AG
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 10 Jun 2015 02:53:05 GMT
Server: Apache
Cache-Control: private, no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Expires: Thu, 09 Feb 1978 12:00:00 GMT
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5874
Content-Type: text/html;charset=utf-8
X-Cnection: close

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

frmregistration fieldsetusernameupdateformerrorsfrmreg fieldstocheck invalidfieldsberistfielderr spannthchild2frmregistrationerremail2 fieldsetemail fielderr20pxfrmregistrationerremail fieldsetemail fielderrfieldmsgnonesieanmeldendeferredtop 0 rightfrmregistrationerrusername2 fieldsetusername fielderrfunctioninvalidfieldslabeltop 0processfrmreg fieldstocheckfacebookheightborderradiusdie0regoptionseventeinen3pxulbackgroundcolornull casecolor15pxfunctioninvalidfields updateformerrorsfrmregbitteregistrierensnamedankeblockcc3333elsecolor ffffffvalidatefieldstocheck functioninvalidfields updateformerrorsfrmregboxshadowfontsize 11pxindexboxshadow 0false0 rightcasemargintopfrmregistrationerrusername fieldsetusernamevar frmreginlineblockfieldsetemail fielderrlicityddpanel ul liuistatefocusfrmregistrationerrusername2 fieldsetusernamesliderfunctioninvalidfields updateformerrorsfrmreg fieldstocheckbei finyafieldsetusername fieldmsgcityfieldstocheck invalidfields ifemailiffrmregistrationallewir8pxkostenlosnichtfunctionespannthchild2werdenidjsonrulesdisplay inlineblockwidthlocationbusyeinif mvaluebchangedtovalidvaluezu3frmregistrationerremailbodyanimate scrolltopescolor cc3333jetztif frmreghasclassservicefacebookfrmregvalueichffffffseekssichfrmregistrationerremail2 fieldsetemailfrmregistration fieldsetusername fielderrfrmregistrationerremail2liscrollyelse if snameflirtenfieldsetusernamejahrefrmreghasclassservicefacebookfrmregistrationokusername fieldsetusernamedisplay nonefontweight 600else iful liuistatefocusvalidatefieldstocheck functioninvalidfieldsprocessfrmregfieldsetemailfieldsetusername fielderrdisplaylocationhref fbloginlocationif mvalue 0undefined4true2mvalue 0frmregistrationokusernamehtml bodyanimate scrolltophtmlpwliscrollxvon10pxvollstndig kostenlosinvalidfields iflocationlastcheckedfrmregistrationerrusernamereturncase keybereitsinvalidfieldscontentpaddingmeinappidmvaluefbloginlocationfrmregistrationerrusername fieldsetusername fielderrssearch11pxoderscrolltopabsolutefunctione epreventdefaultnull case keyfontfamilyfinyavalidatefieldstocheckupdateformerrorsfrmreg fieldstocheckkostenlos registrierenevent uiupdateformerrorsfrmregspannthchild1locationhrefhtml bodyanimatetopif snamenullrightpositionagefontsizeepreventdefaultgetrulesservicesolidfrmregistrationerremail fieldsetemailvarfunctionkeyfinya istfrmregistrationerrusername2functionfailfunctionselflocationhrefvollstndigfieldstocheckposition absolutefbdisplay block1keybodyanimateleftfunctionkey valuegenderzeichenliuistatefocususername1pxaussetslidesliderfrcityddpanelbeicaptchapseudonymbreakdeferredrejectuifontweightmarginleftfielderrcityddpanel ulfielderr spannthchild1fieldstocheck invalidfields

Longtail Keyword Density for

null case key6
else if sname5
updateformerrorsfrmreg fieldstocheck invalidfields5
fieldstocheck invalidfields if3
functioninvalidfields updateformerrorsfrmreg fieldstocheck3
html bodyanimate scrolltop3
validatefieldstocheck functioninvalidfields updateformerrorsfrmreg3
if mvalue 03
frm-registrationerr-username2 fieldset-username field-err3
frm-registrationerr-email fieldset-email field-err3
frm-registrationerr-username fieldset-username field-err3
frm-registration fieldset-username field-err3
city-dd-panel ul liui-state-focus3
top 0 right3
frm-registrationerr-email2 fieldset-email field-err3
else if17
fieldset-username field-err11
case key10
city-dd-panel ul7
color ffffff6
if sname6
null case6
finya ist6
fieldset-email field-err6
display inline-block5
position absolute5
display none5
validatefieldstocheck functioninvalidfields5
fieldstocheck invalidfields5
updateformerrorsfrmreg fieldstocheck5
font-weight 6004
vollstndig kostenlos4
field-err spannth-child14
locationhref fbloginlocation4
field-err spannth-child24
frm-registrationerr-username2 fieldset-username4
frm-registrationerr-username fieldset-username4
functionkey value3
functioninvalidfields updateformerrorsfrmreg3
invalidfields if3
frm-registrationerr-email fieldset-email3
color cc33333
processfrmreg fieldstocheck3
html bodyanimate3
bodyanimate scrolltop3
kostenlos registrieren3
font-size 11px3
if frmreghasclassservice-facebook3
frm-registrationok-username fieldset-username3
display block3
fieldset-username field-msg3
bei finya3
ul liui-state-focus3
box-shadow 03
top 03
functione epreventdefault3
frm-registration fieldset-username3
if mvalue3
mvalue 03
frm-registrationerr-email2 fieldset-email3
event ui3
var frmreg3
0 right3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany France Kingdom United Kingdom Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?