Firmatescil.net Favicon Firmatescil.net

Firmatescil.net Website Thumbnail
Checking...
Invalid URL
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
firmatescil
Domain extension
net
Domain registered:
2019-06-05
Domain updated:
2020-05-04
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is firmatescil.net ranked relative to other sites:

Percentage of visits to firmatescil.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Firmatescil.net registered?
A: Firmatescil.net was registered 1 year, 4 months, 3 weeks, 3 days, 5 hours, 3 minutes, 13 seconds ago on Wednesday, June 5, 2019.
Q: When was the WHOIS for Firmatescil.net last updated?
A: The WHOIS entry was last updated 5 months, 3 weeks, 4 days, 5 hours, 3 minutes, 13 seconds ago on Monday, May 4, 2020.
Q: What are Firmatescil.net's nameservers?
A: DNS for Firmatescil.net is provided by the following nameservers:
  • gwen.ns.cloudflare.com
  • lynn.ns.cloudflare.com
Q: Who is the registrar for the Firmatescil.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Firmatescil.net?
A: Firmatescil.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Firmatescil.net each day?
A: Firmatescil.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Firmatescil.net resolve to?
A: Firmatescil.net resolves to the IPv4 address 104.27.164.70.
Q: In what country are Firmatescil.net servers located in?
A: Firmatescil.net has servers located in the United States.
Q: What webserver software does Firmatescil.net use?
A: Firmatescil.net is powered by CloudFlare webserver.
Q: Who hosts Firmatescil.net?
A: Firmatescil.net is hosted by TOT Public Company Limited in United States.
Q: How much is Firmatescil.net worth?
A: Firmatescil.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Firmatescil.net?

Firmatescil.net Hosting Provider Information

Hosted IP Address:104.27.164.70
Hosted Hostname:104.27.164.70
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Firmatescil.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 22 Sep 2020 04:47:03 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=3600
Expires: Tue, 22 Sep 2020 05:47:03 GMT
Location: https://firmatescil.net/
cf-request-id: 0555bc0d000000bc1e69268200000001
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 5d6962c19895bc1e-LHR

Firmatescil.net Domain Nameserver Information

HostIP AddressCountry
gwen.ns.cloudflare.com 108.162.192.160
lynn.ns.cloudflare.com 108.162.193.201


Need to find out who hosts Firmatescil.net?


WhoIs information for Firmatescil.net

 Domain Name: firmatescil.net
Registry Domain ID: 2398861962_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-05-04T05:38:33Z
Creation Date: 2019-06-05T12:37:49Z
Registrar Registration Expiration Date: 2021-06-05T12:37:49Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: NOG
Registrant State/Province: \u0130stanbulu
Registrant Country: TR
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=firmatescil.net
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=firmatescil.net
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=firmatescil.net
Name Server: GWEN.NS.CLOUDFLARE.COM
Name Server: LYNN.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-05-30T07:00:00Z

Firmatescil.net Free SEO Report

Website Inpage Analysis for Firmatescil.net

H1 Headings

1 :
  1. Invalid URL

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Firmatescil.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Firma-24.com
Firmen in Deutschland finden | firma-24.com
Firma-24.de
Spiralschneider Welches Obst
Firma-admiral.pl
Uprząż rehabilitacyjna dla psa
Firma-aga.eu
Eko servis – Tkaniny Skóry Konserwacja Renowacja
Firma-amb.pl
Ogólnopolski Spis Firm Budowlanych
Firma-anna.pl
Listwy przypodłogowe MDF, PCV i akcesoria do listew - PPHU ANNA
Firma-arcus.pl
Szkoła przedsiębiorczości - jak prowadzić sklep internetowy? -
Firma-arczykowski.com.pl
Poliwęglan zadaszenia pasma klapy dymowe Montaż Konstrukcji Budowlanych Zbigniew Arczykowski
Firma-aris.pl
Firma Handlowa Aris - pióra, zegarki, akcesoria zegarmistrzowskie, artykuły dekoracyjne - Wrocławska Hurtownia Zegarków oraz Artykułów Prezentowych - Wrocław

Recently Updated Websites

Condoomfabriek.nl 1 second ago.Milfdaten.net 2 seconds ago.Brazzerspremium.org 2 seconds ago.Thegaminglife.net 3 seconds ago.Aioautomacao.com 4 seconds ago.Bd-tips.com 4 seconds ago.Shiftplanning.biz 4 seconds ago.Tzzxc4.com 4 seconds ago.Usedfreightlinertrucks.com 5 seconds ago.Ignitingcreativityinbusiness.com 5 seconds ago.Criminallawyerny.com 5 seconds ago.Techbound.in 6 seconds ago.Jembatanmas.co.id 6 seconds ago.Thisoldemare.com 7 seconds ago.Charlielapson.com 7 seconds ago.Legallivesmatter.com 8 seconds ago.Spiritdriving.com 8 seconds ago.Bodyaliveyoga.com 8 seconds ago.Apocapantry.net 10 seconds ago.Thepinesrichfield.com 10 seconds ago.Namastehighlandpark.com 10 seconds ago.Fsjcgs.com 10 seconds ago.Zgszlyw.com 11 seconds ago.Srisubrahmanyaswamydevalayamskandagiri.org 11 seconds ago.Sophistimom.com 11 seconds ago.Kidflair.com 12 seconds ago.5y2c.com 12 seconds ago.Gdmc88.com 12 seconds ago.Russeluno.com 12 seconds ago.Ohsaafb.com 12 seconds ago.