Fitness.com.hr - najveći fitness portal - vježbe, zdrava prehrana, mršavljenje

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 570,229
Estimated Worth: $2,400
Category: Sports

Najveći fitness portal u Hrvatskoj. Svakodnevno pratite naše stručne savjete vezano za vježbanje, zdravu prehranu, mršavljenje i zdravlje.



Domain summary

Last updated
2021-09-22
Domain label
fitness
Domain extension
com.hr
Global Traffic Rank
570,229
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,400
Estimated daily income
$10
Estimated monthly income
$304

Frequently Asked Questions (FAQ)

Q: When was Fitness.com.hr registered?
A: Fitness.com.hr was registered 3 days, 21 hours, 32 minutes, 28 seconds ago on Wednesday, September 22, 2021.
Q: When was the WHOIS for Fitness.com.hr last updated?
A: The WHOIS entry was last updated 3 days, 21 hours, 32 minutes, 28 seconds ago on Wednesday, September 22, 2021.
Q: What are Fitness.com.hr's nameservers?
A: DNS for Fitness.com.hr is provided by the following nameservers:
  • karina.ns.cloudflare.com
  • phil.ns.cloudflare.com
Q: Who is the registrar for the Fitness.com.hr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Fitness.com.hr?
A: Fitness.com.hr ranks 570,229 globally on Alexa. Fitness.com.hr has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Fitness.com.hr each day?
A: Fitness.com.hr receives approximately 1,543 visitors and 3,086 page impressions per day.
Q: What IP address does Fitness.com.hr resolve to?
A: Fitness.com.hr resolves to the IPv4 address 104.21.5.40.
Q: In what country are Fitness.com.hr servers located in?
A: Fitness.com.hr has servers located in the United States.
Q: What webserver software does Fitness.com.hr use?
A: Fitness.com.hr is powered by CloudFlare webserver.
Q: Who hosts Fitness.com.hr?
A: Fitness.com.hr is hosted by CloudFlare, Inc. in United States.
Q: How much is Fitness.com.hr worth?
A: Fitness.com.hr has an estimated worth of $2,400. An average daily income of approximately $10, which is roughly $304 per month.

Fitness.com.hr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Fitness.com.hr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Fitness.com.hr

H1 Headings

1 :
  1. Fitness.com.hr

H2 Headings

5 :
  1. Navigation
  2. 6 razloga zašto kupiti orbitrek
  3. Smoothie od banane: 5 jednostavnih recepata!
  4. Zeleni čaj - zašto je toliko popularan i po čemu je poseban?
  5. Fitness centri

H3 Headings

9 :
  1. Vježbe
  2. Prehrana
  3. Mršavljenje
  4. Zdravlje
  5. Lifestyle
  6. Sport
  7. Fit
  8. Istaknuti blog
  9. Istaknuti recept

H4 Headings

27 :
  1. Prijavi se!
  2. Nema problema!
  3. 10 najboljih vježbi za leđa
  4. Do savršeno ravnog trbuha sa samo 10 minuta vježbi dnevno!
  5. Kružni trening za ruke i prsa s jednim setom bučica
  6. 20 recepata za zdravi obrok ispod 250 kalorija
  7. 10 keto recepata za sve obroke u danu
  8. Fenomenalno: Sirova (raw) torta od kokosa i badema
  9. Dobra vijest: Čista kava pola sata prije treninga pojačava topljenje masnoga tkiva!
  10. Mršavljenje - stvar čiste matematike ili nešto više?
  11. Kako brzo izgubiti kilograme: 3 jednostavna, znanstveno potvrđena koraka!
  12. Što učiniti kad osjetite bolove u slabinskoj kralježnici - križobolju?
  13. Moramo li zaista napraviti 10.000 koraka na dan za optimalno zdravlje?
  14. Ozljede rotatorne manšete - uzroci i rehabilitacija
  15. Trendi pametni satovi koji brinu o tvojem zdravlju: Samsung Galaxy Watch4 i Watch4 Classic
  16. Novi Guinessov rekord: Australac ostao u planku 9 sati, 30 minuta i 1 sekundu!
  17. Kako vam orahovo ulje može pomoći u zdravlju kose i kože?
  18. Za početnike: Kad trčanje postaje lagano i ugodno?
  19. Kako se u 4 tjedna pripremiti za istrčati 5 kilometara?
  20. Na što sve treba pripaziti, kad odlučite voziti bicikl tijekom ljetnih mjeseci?
  21. Kalkulator kalorijske vrijednosti obroka
  22. Kalkulator potrošnje kalorija
  23. Bazalni metabolizam - kalkulator
  24. Najnovije na fitu
  25. Izdvojeno iz Webshopa
  26. Jesu li ljudi zaista biljojedi ?
  27. 10 keto recepata za sve obroke u danu

H5 Headings

13 :
  1. Naravno da smiješ, dapaèe. Masnoæe su nam neophodne za pravilno funkcioniranje organizma. Ja uopæe n...
  2. Hvala!
  3. Hm, da, mislim da si u pravu, imam puno tih obroka s jednom skupinom namirnica. Znaèi smijem dodati ...
  4. Ok :). Reci mi, koliko si ti sita s ovakvim obrocima? Koliko su ostali dani slièni ovome i kako je ...
  5. Juèer sam da doruèak pojela jedno 5 manjih komada štrudle od jabuka, za medjuobrok grožðe, išla sam ...
  6. Bok! Lijekove sam prestala piti jer mi ih je dala lijeènica opæe prakse, bez ikakvih dodatnih pretra...
  7. Whey 100 - 1 kg
  8. Tatami strunjača - 2 cm
  9. 14-dnevni jelovnik za mršavljenje s receptima
  10. Dodaci prehrani
  11. Fitness oprema
  12. Hrana
  13. Sportska oprema

H6 Headings

1 :
  1. Fitness.com.hr vodeći je i najposjećeniji fitness portal u HR!

Total IFRAMEs

1 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-3294775-1

Links - Internal

169:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Fitness.com.hr

mkalkulatorsamdebelatetkaforumililankesu3ispremiumljudiispremium nameviename ispremiumukojiza svevjebipostojikakozdravlje21092021 debelatetka forum4varo0naslovnavidi sveispremium name ispremiumworkinghoursza vjebanjenezafitnesswheylifestylenamasvefitdajeopremafunction1email000vrijemerecepata zacmsportnewnamekadknne postojiodfitnesscomhrispremium ispremium namenavidi sve lankes prekoprehranarecepatasproitaj21092021 debelatetkaispremium ispremiumprekoproitaj vieblogsve lankevidisenapitcimravljenjevjebeobrokadebelatetka forumvjebanje2map

Who hosts Fitness.com.hr?

Fitness.com.hr Hosting Provider Information

Hosted IP Address:104.21.5.40
Hosted Hostname:104.21.5.40
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
CloudFlare, Inc.
1.3000%

HTTP Header Analysis for Fitness.com.hr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 22 Sep 2021 07:00:08 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
cache-control: private
vary: Accept-Encoding
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=zIyPq3i8vDH55nTBIL11PWAqGwLjR8KP4QAKbV3JCjoLYfRrIHJduy2CQ13Jzh4e7m/gZY0rnyhTbitmdv/63yjavROj7XlHrp4+ZXZId7hVYuatiUJ7HrT9Zpk9aLoqJPmo/3M="}],"group":"cf-nel","max_age":604800}
NEL: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 6929a78ced30075e-LHR
Content-Encoding: gzip
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400, h3-28=":443"; ma=86400, h3-27=":443"; ma=86400

Fitness.com.hr Domain Nameserver Information

HostIP AddressCountry
karina.ns.cloudflare.com 108.162.192.178
phil.ns.cloudflare.com 172.64.33.137


Need to find out who hosts Fitness.com.hr?


Domain Registration (WhoIs) information for Fitness.com.hr

 % This is the RIPE Database query service.
% The objects are in RPSL format.
%
% The RIPE Database is subject to Terms and Conditions.
% See http://www.ripe.net/db/support/db-terms-conditions.pdf

% Note: this output has been filtered.
% To receive output for a database update, use the "-B" flag.

%ERROR:101: no entries found
%
% No entries found in source RIPE.

% This query was served by the RIPE Database Query Service version 1.101 (ANGUS)

Websites with Similar Names

Fitne-ss.com
wine-s.com | Wine
Fitne.de
FITNE – Health Care
Fitne.eu
FITNE – Health Care
Fitne.one
fitne.one
Fitnea.com
Fitnea.Com | Stay Fit
Fitnealth.com
Fitnealth – Fitness & Health Gear
Fitneamos.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Fitneass.com
Fitneass - Weight loss plans, workouts, and tips you can rely on.
Fitnebody.com
fitnebody.com

Recently Updated Websites

Americanbaptist.org (5 seconds ago.)Concealedcarryfirearms.us (7 seconds ago.)Easygame88.com (8 seconds ago.)Szmohua.com (8 seconds ago.)Furryhentaisex.com (9 seconds ago.)Shlongpai.com (10 seconds ago.)Interviewsoon.com (14 seconds ago.)Sahmff.com (15 seconds ago.)Boudoirgalmour.com (16 seconds ago.)Nebula71.com (18 seconds ago.)Fedexintl.com (25 seconds ago.)Everhartdesignco.com (26 seconds ago.)Exothermicllc.com (26 seconds ago.)Earthyminds.com (26 seconds ago.)Fetishsex.xyz (27 seconds ago.)Susantaylorpropst.com (27 seconds ago.)Berenguer.net (38 seconds ago.)Westrafidain.com (39 seconds ago.)Grohe.blue (42 seconds ago.)Thecshore.com (46 seconds ago.)Buerodienste-in.de (49 seconds ago.)Jianyeshidai.com (50 seconds ago.)Westshorecommercial.com (51 seconds ago.)Esvanet.com (53 seconds ago.)Zhiyjc.com (55 seconds ago.)Plumesetconfettis.com (56 seconds ago.)Xtxlxs.com (58 seconds ago.)Centrodeipavimenti.com (1 minute 3 seconds ago.)Spl-acc.com (1 minute 5 seconds ago.)Outdoorpornstars.com (1 minute 5 seconds ago.)

Recently Searched Keywords

gaming playtech (4 seconds ago.)sleepy at work gif (9 seconds ago.)olimp fast food (9 seconds ago.)второй раз пьяный за рулем без прав наказание (10 seconds ago.)dubel3 (11 seconds ago.)beberapa manfaat (13 seconds ago.)unser vorstand (16 seconds ago.)decizia consiliului municipal chisinau privind taxele locale 2020 (20 seconds ago.)scheme thisgetscheme (21 seconds ago.)leuke vragen voor vrienden liefde (22 seconds ago.)fandome (25 seconds ago.)30 best foods to eat for diabetes (26 seconds ago.)171+187 (26 seconds ago.)dch v cn (27 seconds ago.)squonk (27 seconds ago.)3k 2019 (28 seconds ago.)llb southeast region (30 seconds ago.)des mains soin (32 seconds ago.)tyjm (35 seconds ago.)agenda (35 seconds ago.)crocs india (35 seconds ago.)dress material (37 seconds ago.)20200204 100740 (37 seconds ago.)technology education (39 seconds ago.)livescore cz result just now (40 seconds ago.)praise the lord lyrics (41 seconds ago.)ministerio de desarrollo agrario agroecologia (41 seconds ago.)nga meaning (42 seconds ago.)bold brand names (44 seconds ago.)vez (45 seconds ago.)