Flagmankab.ru

Website Thumbnail
Checking...
Гостевой дом "ФЛАГМАН"|Отдых в Кабардинке

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-29
Category: This site has not been categorized yet

Отдых в Кабардинке . Гостевой дом "Флагман" в Кабардинке предлагает уютные , комфортабельные номера по доступным ценам. тел. +7 928 237 1386


Domain summary

Domain label
flagmankab
Domain extension
ru
Domain registered:
2016-06-24
Domain updated:
2020-10-29
Domain expires:
2021-06-24
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is flagmankab.ru ranked relative to other sites:

Percentage of visits to flagmankab.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Flagmankab.ru registered?
A: Flagmankab.ru was registered 4 years, 5 months, 1 week, 1 hour, 59 minutes, 38 seconds ago on Friday, June 24, 2016.
Q: When was the WHOIS for Flagmankab.ru last updated?
A: The WHOIS entry was last updated 1 month, 3 days, 1 hour, 59 minutes, 38 seconds ago on Thursday, October 29, 2020.
Q: What are Flagmankab.ru's nameservers?
A: DNS for Flagmankab.ru is provided by the following nameservers:
  • ns6.wixdns.net
  • ns7.wixdns.net
Q: Who is the registrar for the Flagmankab.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Flagmankab.ru?
A: Flagmankab.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Flagmankab.ru each day?
A: Flagmankab.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Flagmankab.ru resolve to?
A: Flagmankab.ru resolves to the IPv4 address 23.236.62.147.
Q: In what country are Flagmankab.ru servers located in?
A: Flagmankab.ru has servers located in the United States.
Q: What webserver software does Flagmankab.ru use?
A: Flagmankab.ru is powered by webserver.
Q: Who hosts Flagmankab.ru?
A: Flagmankab.ru is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Flagmankab.ru worth?
A: Flagmankab.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Flagmankab.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Flagmankab.ru Free SEO Report

Website Inpage Analysis for Flagmankab.ru

H1 Headings

0 :

H2 Headings

2 :
  1. Бесплатный номер тел.
  2. 8(800)201-70-86

H3 Headings

0 :

H4 Headings

3 :
  1. Комнаты и расценки
  2. Адрес
  3. Развлечения

H5 Headings

4 :
  1. +7 (928) 237-13-86
  2.    8(800) 201-70-86
  3.   

H6 Headings

0 :

Total IFRAMEs

6 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

1:
  1. http://vk.com/mykabardinka
    http://vk.com/mykabardinka

Links - Outbound (nofollow)

0:

Keyword Cloud for Flagmankab.ru

arial sansserifdisplaynonefont normalrgba255153 153border0px solidimportant1c95efnbspsolid rgba15309fontsize0margintop5pxsolid rgba255helveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055roma7 928 237ul04s ease 0ssvgnbold 13px14em arialwidth100height100backgroundrgba255153 153 1n n nhelveticaneuew1055roma helveticasc1bgultxtnewneue helveticaneuew0155roman n7color2b2a28helveticaneuew0155romanormal normalease 0spositionabsolutewidth100height100overflowhiddenstylejti65lxzrepeaterbuttongapper border0249 1backgroundcolorrgba25504smargin0lineheightnormalletterspacingnormalrgba0 0 0backgroundcolor ffffffhelveticaneuew0255roma helveticaneuew1055roma5249 249ifselectdatapreviewerror stylejti65lxznavcontainerarrowiframewebkitfullscreenfont normal normalultxtnew ol1 stylejti65lxznavcontainer000000pgothicdotumhelveticasansserif color2b2a28normal normal normalhelvetica0 0border0helvetica arialcalc100solid rgba255 255980px 05iframe positionabsolutewidth100height100overflowhidden0color373737fontfamilyhelvetica neue13px14em arialhelveticaneuew1055romaborderwidth2px borderstylesolidbordercolorrgba249255 1 stylejti65lxznavcontainerbold12sansserifdisplaynone255 2551borderbottom0px solidnormal bold 13px14em11255 1selectdatapreviewhover159 166positionfixed importantleftauto importantzindex50153 1calc100 980px1opacity1minheightauto importantstylejti65lxznavcontainercenterdirection928 237rgba0 0dinnextw01lightdinnextw02lightdinnextw10lightsansserif color2b2a28rgba130 126126 1221borderbottom0pxdisplaynoneimportantleftautoscriptcursivedinnextw01lightdinnextw02lightdinnextw10lightsansserifstylejti65lxznavcontainerarrowrgba130 126 1227 928calc100 980px 05marck scriptcursiveneue helveticaneuew0155roma helveticaneuew0255roma10left10pxright10pxhelvetica arial sansserifdisplaynonefontnormal normalnormalarial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterstylejti65lxznavcontainerarrowstylejti65lxznavcontainercenterdirectionnbsp nbsp nbspwidth100height100backgroundrgba255 255 255topautobottom0importantzindex50b1labelvarwidth100height1000s2stylejti65lxzrepeaterbuttonlabel13px14em arial msneue249 1backgroundcolorrgba255 255marginleft calc100overflowhiddenolselectdatapreviewfocus204 204colorpositionfixedpositionabsolutetop0right0bottom0left0arial ms pgothicdotumhelveticasansseriffontfamilyhelvetica neue helveticaneuew0155romafontffffff13px14emoldirrtlminheightautosansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenter1backgroundcolorrgba255 255bold 13px14emborderstylesolidbordercolorrgba249 249 249selecthoverrgba255 255249 249 1backgroundcolorrgba255marginleft calc100 980pxol ultxtnewms pgothicdotumhelveticasansserifnbsp nbspcolor373737fontfamilyhelvetica neue helveticaneuew0155roma04s easestylejti65lxznavcontainerborderstylesolidbordercolorrgba249 2491px255 255 1helveticaneuew0255roma helveticaneuew1055roma helveticadisplayinlineblock1backgroundcolorrgba255selectfocus9helveticaneuew0155roma helveticaneuew0255romacolor0099fftextdecorationunderlinecursorpointerlb1itemscontainerpositionabsolutetop0left0color373737width100height100borderwidth2px borderstylesolidbordercolorrgba249 249marckhelveticaneuew1055roma helvetica arialborderwidth2pxcolor ffffff4txtnew ulpgothicdotumhelveticasansserifbackgroundcolorfontnormaliframe05selectdataerrortrueimportantleftauto importantzindex50stylejti65lxzrepeaterbuttondatastatedropeasergba1533color373737fontfamilyhelveticaselectdatapreviewerrorrgba255 255 255margin0lineheightnormalletterspacingnormal txtnew8stylejti65lxznavcontainersvgcontaineriframewebkitfullscreen minheightauto importantwidth100height100backgroundrgba255 2551backgroundcolorrgba255 255 255stylejti65lxznavcontainerrightdirection255 09fontsize0margintop5pxstylejti65lxznavcontainerarrow stylejti65lxznavcontainersvgcontainerhelveticaneuew0255romaiframewebkitfullscreen minheightautostylejti65lxznavcontainerarrowstylejti65lxznavcontainerleftdirectionmarginleftfontfamilyhelveticahelvetica arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterstylejti65lxznavcontainerarrowstylejti65lxznavcontainerrightdirection255 255 09fontsize0margintop5pxstylejt5zegq9bgarialb1labelwrappermsstylejti65lxzrepeaterbuttongapperborder0pxpositionfixed importantleftautoborderstylesolidbordercolorrgba249stylejti65lxznavcontainerleftdirectionborderradius0b1linknormal boldrgba0fontfamilyhelvetica neue980pxms pgothicdotumhelveticasansserif color2b2a28normal normal boldsolidarial ms6rgba130

Longtail Keyword Density for Flagmankab.ru

KeywordsOccurences
margin-left calc100 980px29
calc100 980px 0529
nbsp nbsp nbsp15
font normal normal11
04s ease 0s9
normal normal bold6
arial ms pgothicdotumhelveticasans-serif6
helveticaneuew10-55roma helvetica arial6
helveticaneuew02-55roma helveticaneuew10-55roma helvetica6
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma6
neue helveticaneuew01-55roma helveticaneuew02-55roma6
255 255 15
normal normal normal5
rgba0 0 05
n n n4
rgba130 126 1224
7 928 2374
1background-colorrgba255 255 2554
border-width2px border-stylesolidborder-colorrgba249 2494
border-stylesolidborder-colorrgba249 249 2494
153 153 14
positionfixed importantleftauto importantz-index504
helvetica arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
ms pgothicdotumhelveticasans-serif color2b2a283
normal bold 13px14em3
bold 13px14em arial3
helvetica arial sans-serifdisplaynone3
font-familyhelvetica neue helveticaneuew01-55roma3
249 249 1background-colorrgba2553
13px14em arial ms3
solid rgba255 2553
255 1 style-jti65lxznavcontainer3
color373737font-familyhelvetica neue helveticaneuew01-55roma3
255 255 09font-size0margin-top5px3
width100height100backgroundrgba255 255 2553
iframe-webkit-full-screen min-heightauto important3
rgba255 255 2553
249 1background-colorrgba255 2553
980px 0529
calc100 980px29
margin-left calc10029
nbsp nbsp19
normal normal16
255 25514
0 013
font normal11
04s ease10
ease 0s9
normal bold8
margin0line-heightnormalletter-spacingnormal txtnew7
helveticaneuew02-55roma helveticaneuew10-55roma6
neue helveticaneuew01-55roma6
helveticaneuew01-55roma helveticaneuew02-55roma6
helveticaneuew10-55roma helvetica6
helvetica arial6
153 1536
n n6
arial ms6
ms pgothicdotumhelveticasans-serif6
255 15
7 9285
marck scriptcursive5
rgba0 05
249 2494
1background-colorrgba255 2554
928 2374
txtnew ul4
importantleftauto importantz-index504
positionfixed importantleftauto4
rgba130 1264
border-width2px border-stylesolidborder-colorrgba2494
border-stylesolidborder-colorrgba249 2494
204 2044
153 14
1 style-jti65lxznavcontainer4
126 1224
fontnormal normal3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color2b2a283
13px14em arial3
style-jti65lxznavcontainerarrow style-jti65lxznavcontainersvgcontainer3
159 1663
solid rgba1533
arial sans-serifdisplaynone3
font-familyhelvetica neue3
arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
pgothicdotumhelveticasans-serif color2b2a283
bold 13px14em3
color373737font-familyhelvetica neue3
color ffffff3
background-color ffffff3
style-jti65lxzrepeaterbuttongapper border03
255 09font-size0margin-top5px3
width100height100backgroundrgba255 2553
min-heightauto important3
iframe-webkit-full-screen min-heightauto3
iframe positionabsolutewidth100height100overflowhidden3
249 1background-colorrgba2553
solid rgba2553
border0px solid3
ol ul3
ultxtnew ol3
1border-bottom0px solid3
selectdata-previewerror style-jti65lxznavcontainerarrow3
rgba255 2553
background-color37
color36
031
normal31
0529
980px29
calc10029
margin-left29
128
nbsp25
positionabsolutetop0right0bottom0left022
218
txtnew18
border-radius013
style-jti65lxznavcontainer13
arial12
solid12
312
style-jti65lxznavcontainerarrow11
font11
ul10
important10
410
ease10
04s10
0s9
displaynone8
58
n8
bold8
color2b2a288
margin0line-heightnormalletter-spacingnormal7
ol7
var7
style-jti65lxzrepeaterbuttongapper6
ms6
neue6
helveticaneuew01-55roma6
helveticaneuew02-55roma6
helveticaneuew10-55roma6
helvetica6
ffffff6
style-jti65lxznavcontainerarrowstyle-jti65lxznavcontainercenter-direction6
style-jti65lxznavcontainerarrowstyle-jti65lxznavcontainerright-direction6
pgothicdotumhelveticasans-serif6
positionabsolutetop0left0color373737width100height1006
66
style-jti65lxznavcontainerarrowstyle-jti65lxznavcontainerleft-direction6
scriptcursive5
rgba05
ultxtnew5
75
if5
marck5
85
overflowhidden4
rgba1534
svg4
b1label4
1c95ef4
b1link4
b1labelwrapper4
width100height1004
border-stylesolidborder-colorrgba2494
iframe4
94
0000004
border-width2px4
positionfixed4
border04
topautobottom04
importantz-index504
importantleftauto4
lb1itemscontainer4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif4
style-jti65lxzrepeaterbuttonlabel4
1background-colorrgba2554
rgba1304
104
displayinline-block3
color373737font-familyhelvetica3
113
123
opacity13
font-familyhelvetica3
sans-serifdisplaynone3
09font-size0margin-top5px3
sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
color0099fftext-decorationunderlinecursorpointer3
fontnormal3
width100height100backgroundrgba2553
style-jti65lxznavcontainercenter-direction3
style-jti65lxznavcontainersvgcontainer3
style-jti65lxznavcontainerleft-direction3
selecthover3
selectdata-previewhover3
selectfocus3
selectdata-previewfocus3
selectdata-errortrue3
selectdata-previewerror3
style-jti65lxznavcontainerright-direction3
border0px3
min-heightauto3
style-jti65lxzrepeaterbuttondata-statedrop3
style-jt5zegq9bg3
1border-bottom0px3
left10pxright10px3
oldirrtl3
sc1bg3
rgba2553
1px3
positionabsolutewidth100height100overflowhidden3
iframe-webkit-full-screen3
13px14em3

Who hosts Flagmankab.ru?

Flagmankab.ru Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Flagmankab.ru

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 29 Oct 2020 19:45:49 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.flagmankab.ru/
x-wix-request-id: 1604000749.089567507822495930484
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkViozyX1iilefXjG31S4IO7n,2d58ifebGbosy5xc FRalu6uRcZpiz4B0JtKCh7dvTM4z876YMifFjtS3Q4OX6od6dBFKYr/8 bY5HIS jAjw==,2UNV7KOq4oGjA5 PKsX47EfZRIGggBRRQO6W0jtN ls=,m0j2EEknGIVUW/liY8BLLmYVHm1DtakfzSOTrFG0wKU=,8Jozq2XDr5/0Pv3E0yMndz6ZvWM2wHaxGpnGE3HwkycaWyug/ZdHQ36uOAkr89T0,znxyTGNb715cyF9N4jtLDGt82yOKU8Cvg4kCZXbUA2YvFz7xf/EKbYze zqFlJoj
Cache-Control: no-cache
Expires: -1

Flagmankab.ru Domain Nameserver Information

HostIP AddressCountry
ns6.wixdns.net 216.239.32.100
ns7.wixdns.net 216.239.34.100


Need to find out who hosts Flagmankab.ru?


Domain Registration (WhoIs) information for Flagmankab.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: FLAGMANKAB.RU
nserver: ns6.wixdns.net.
nserver: ns7.wixdns.net.
state: REGISTERED, DELEGATED, UNVERIFIED
person: Private Person
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2016-06-24T08:10:43Z
paid-till: 2021-06-24T08:10:43Z
free-date: 2021-07-25
source: TCI

Last updated on 2020-07-04T07:31:30Z

Websites with Similar Names

Flagm.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Flagma-az.com
Azərbaycan Elanlar, Flagma-az.com
Flagma-cy.com
Κύπρος Αγγελίες, Flagma-cy.com
Flagma-eg.com
مصر‎‎ الإعلانات المبوبة, Flagma-eg.com
Flagma-fi.com
Suomi Ilmoitukset, Flagma-fi.com
Flagma-ge.com
საქართველო განცხადებები, Flagma-ge.com
Flagma-kg.com
Кыргызстан Жарыялоо, Flagma-kg.com
Flagma-no.com
Norge Annonser, Flagma-no.com
Flagma-rs.com
Србија Огласи, Flagma-rs.com
Flagma-tj.com
Тоҷикистон Эълонҳо, Flagma-tj.com

Recently Updated Websites

Triggerappy.com (2 seconds ago.)Unitedhempfiber.com (3 seconds ago.)Yabotiyu1219.com (4 seconds ago.)Toxicfreejournal.com (5 seconds ago.)Yabotiyu1400.com (6 seconds ago.)Yabotiyu1748.com (7 seconds ago.)Trillwoodstudios.com (7 seconds ago.)Td385.com (16 seconds ago.)Tryitman.com (16 seconds ago.)Wyndhamgrandsouthcoastjomtien.com (18 seconds ago.)Watersofteningtreatment.com (19 seconds ago.)Umeda-gloryflower.com (20 seconds ago.)Www312green.com (20 seconds ago.)Tiny-dresses.com (20 seconds ago.)Trustthetruffle.com (24 seconds ago.)Td422.com (25 seconds ago.)Trgpia.com (29 seconds ago.)Trimmellecertcs.com (30 seconds ago.)Victoriatrandds.com (33 seconds ago.)Un00si.com (35 seconds ago.)Yabotiyu1798.com (36 seconds ago.)Trgpak.com (37 seconds ago.)Tupperwareproductsinhyderabad.com (37 seconds ago.)Waytechmold.com (40 seconds ago.)Westhollywoodcoffeeshop.com (40 seconds ago.)Truemobilehome.com (41 seconds ago.)Unitedriverside.com (43 seconds ago.)Typesofdietss.com (44 seconds ago.)Tricksblogging.com (46 seconds ago.)Urganicsskincare.com (46 seconds ago.)

Recently Searched Keywords

titlelines var (1 second ago.)wwww full form (1 second ago.)vibrator (1 second ago.)uprrp asistencia economica (1 second ago.)sa アプリ&ポイント (2 seconds ago.)lineheight realheight px (2 seconds ago.)con4513page 1 (2 seconds ago.)guitar european maplespruce (2 seconds ago.).a{stroke: (2 seconds ago.)bysnapshotsdecember 9 (2 seconds ago.)examining (3 seconds ago.)skills review appointments (4 seconds ago.)trixie dianne te (4 seconds ago.)正在更下程度改造开放中彰隐经济特区新做为 (5 seconds ago.)svfindw-list-desccssline-height svfindw-list-desccssheight (5 seconds ago.)メンバーシップ (5 seconds ago.)andmax-width 768pxonly (5 seconds ago.)informed about events (5 seconds ago.)changing world publication (6 seconds ago.)navigationtext pagination false (6 seconds ago.)translate english to malayalam (6 seconds ago.)kiến thức sale bđs (7 seconds ago.)managed connectivity (7 seconds ago.)twas the night before christmas text (7 seconds ago.)style-k0aqgh3mitem border-radius0 (8 seconds ago.)torqcfa (9 seconds ago.)comfort (9 seconds ago.)doctop (10 seconds ago.)var titlelines (10 seconds ago.)アニマル シリーズ 2 (10 seconds ago.)