Flyms.org Favicon Flyms.org

Flyms.org Website Thumbnail
Checking...
Fly for MS 20,000 mile flight
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
flyms
Domain extension
org
Domain registered:
2010-10-07
Domain updated:
2020-10-14
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is flyms.org ranked relative to other sites:

Percentage of visits to flyms.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Flyms.org registered?
A: Flyms.org was registered 10 years, 2 weeks, 2 days, 3 hours, 19 minutes, 45 seconds ago on Thursday, October 7, 2010.
Q: When was the WHOIS for Flyms.org last updated?
A: The WHOIS entry was last updated 1 week, 2 days, 3 hours, 19 minutes, 45 seconds ago on Wednesday, October 14, 2020.
Q: What are Flyms.org's nameservers?
A: DNS for Flyms.org is provided by the following nameservers:
  • ns46.domaincontrol.com
  • ns45.domaincontrol.com
Q: Who is the registrar for the Flyms.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Flyms.org?
A: Flyms.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Flyms.org each day?
A: Flyms.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Flyms.org resolve to?
A: Flyms.org resolves to the IPv4 address 198.185.159.144.
Q: In what country are Flyms.org servers located in?
A: Flyms.org has servers located in the United States.
Q: What webserver software does Flyms.org use?
A: Flyms.org is powered by Squarespace webserver.
Q: Who hosts Flyms.org?
A: Flyms.org is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Flyms.org worth?
A: Flyms.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Flyms.org?

Flyms.org Hosting Provider Information

Hosted IP Address:198.185.159.144
Hosted Hostname:198.185.159.144
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Flyms.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Wed, 14 Oct 2020 06:21:20 GMT
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
content-type: text/html;charset=utf-8
content-encoding: gzip
etag: W/"4cf7cf07b5cc733def2e125ef79a1af7"
content-length: 36579
Vary: Accept-Encoding
Age: 54702
Accept-Ranges: bytes
x-contextid: py1uBY5V/LPYjiGZn
server: Squarespace

Flyms.org Domain Nameserver Information

HostIP AddressCountry
ns46.domaincontrol.com 173.201.70.23
ns45.domaincontrol.com 97.74.102.23


Need to find out who hosts Flyms.org?


WhoIs information for Flyms.org

 Domain Name: FLYMS.ORG
Registry Domain ID: D159618343-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2019-07-11T13:31:50Z
Creation Date: 2010-07-10T01:10:22Z
Registry Expiry Date: 2021-07-10T01:10:22Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization:
Registrant State/Province: New York
Registrant Country: US
Name Server: NS45.DOMAINCONTROL.COM
Name Server: NS46.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-14T21:32:04Z

Flyms.org Free SEO Report

Website Inpage Analysis for Flyms.org

H1 Headings

2 :
  1. 20,000 miles for multiple sclerosis
  2. We give wings to those who cannot walk.

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

45 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

1:
  1. ENTER SITE
    http://flyms.org/intro

Links - Internal (nofollow)

0:

Links - Outbound

4:
  1. No text
    https://www.facebook.com/fly4ms
  2. No text
    http://instagram.com/flymsofficial
  3. No text
    https://twitter.com/Fly4MS
  4. LEARN ABOUT 2010 MISSION
    http://www.fly4ms.org/

Links - Outbound (nofollow)

0:

Keyword Cloud for Flyms.org

dataslicetypecountdown countdowncontentdataformatnumerictidaldataslicetypesocialiconshover foursquarehoverapplepodcast2s easeinotransitionopacityuseiconfill0099e5sqsslidewrapperdataslidetypecoverpagedataslicetypegallery galleryvideobackgroundmobile2s easeinotransitionopacity 2ssqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbum170ms easeinoutmstransitionbackgroundcolor 170msdataslicetypesocialiconssocialiconssizeextralargesocialiconsstylesolidulstackedtweetbodythedotsdataslicetypetwitterdataslicetypesocialiconshover pinteresthoverdataslicetypesocialiconshover instagramhover1ssocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagetracksdataslicetypesocialiconshover twitchdataslicetypesocialiconshover snapchatthedotshoverimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfillf94877sqsslidewrapperdataslidetypecoverpagebuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeduseiconfillf60sqsslidewrapperdataslidetypecoverpageul lidatacompoundtypepopupoverlayactionusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover spotify2s easeinmoztransitionopacitysvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidsvgsocialwebkittransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautoiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledlightboxinnerlinkedindataslicetypesocialicons vevoasqsslidewrapperdataslidetypecoverpage dataslicetypetwitteruseiconfill7ac143sqsslidewrapperdataslidetypecoverpageactionsnotstackedbuttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypetwitternotdatacompoundtype tweettimestampactionssqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons linkedinuseiconfillea4c89sqsslidewrapperdataslidetypecoverpagehouzzhoverbandsintownhover8pxeaseinmoztransitionopacitycodepenhoverdataslicetypesocialicons tumblrsqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftdataslicetypesocialiconshover googlehovercodepensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshover2s easesqsslidewrapperdataslidetypecoverpagevscohovergithubrdioapplepodcasthovervimeohoverp asqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons tidaldataslicetypesocialiconshover iconwrappertrackasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformeaseinoutotransitioncolorsqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactionfacebooksocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshover170ms easeinouttransitionbackgroundcolor 170mseaseoutopacity 170msuseiconfille4405fsqsslidewrapperdataslidetypecoverpageuseiconfille0393esqsslidewrapperdataslidetypecoverpagesocialiconsstyleregular dataslicetypesocialiconsiconwrapperwidth32pxheight32pxmargin0ulsqsslidewrapperdataslidetypecoverpageusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagetwitchhoverdataslicetypesocialiconshovererrormessagesqsslidewrapperdataslidetypecoverpagedribbblehoverdataslicetypesocialiconshover yelphoverfoursquarehoverimdbdataslicetypesocialiconshover smugmuguseiconfillfffsqsslidewrapperdataslidetypecoverpagereddithoverdataslicetypebuttons ulsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlayspotifyhoverdataslicetypesocialicons vscodatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpagesqssliceplaybuttoniconwrapperhoversocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsinputtypetextsqsslidewrapperdataslidetypecoverpageul lisqsslidewrapperdataslidetypecoverpageeaseinoutotransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddenitunesuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolidsoundcloud0alignmentcenter responsivewrapperstackedtracktitledataslicetypesocialiconshover youtubeeaseinoutotransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterlockstyleknockoutdataslicetypesocialicons squarespacehouzzresponsivewrapperstackeddataslicetypepassword arrowicondataslicetypesocialiconshover vevohoverdataslicetypemap gmnoprinticonwrappersqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stitcherhoverusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutuseiconfilldc4e41sqsslidewrapperdataslidetypecoverpagesqsslicealbumplaylistdemoalbumdataslicetypesocialicons behancesocialiconssizelargesocialiconsstyleknockoutdataslicetypesocialiconshover vevodataslicetypesocialiconshover pinteresteaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsdataslicetypesocialicons facebook10pxdataslicetypesocialicons githubaudioplayericonsstylesolid dataslicetypealbumhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperdataslicetypesocialicons itunesvinehoverdisplaytablesqsslidewrapperdataslidetypecoverpageyelphoverdataslicetypebuttons lisqsslidewrapperdataslidetypecoverpageusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshovertweethandleasqsslidewrapperdataslidetypecoverpage buttonstyleoutlineuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshovereaseinmstransitionopacity 2sdataslicetypesocialiconshover githubeaseinoutmoztransitionbackgroundcolor 170msformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinesqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackedsqsslidewrapperdataslidetypecoverpage dataslicetypebuttonssocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage2em 0px 0pxiconwrapperbuttonstyleoutlinesqsmodallightbox formwrapperuseiconfill00b488sqsslidewrapperdataslidetypecoverpagesolid2s easeintransitionopacityuseiconfill6441a5sqsslidewrapperdataslidetypecoverpageuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularituneshoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover imdbhoverdataslicetypesocialicons googleplaydataslicetypesocialiconshover stitchersocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoversocialiconssizeextrasmallsocialiconsstyleknockout2s easeinmstransitionopacity 2sdataslicetypebuttons li asqsslidewrapperdataslidetypecoverpageuseiconfill006ed2sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover ituneshovertrackprogressbarneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpagetumblrsocialiconssizeextralargesocialiconsstyleborderbehance2s 2suseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpageuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsvevosqsmodallightboxsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsuseiconfillec4652sqsslidewrapperdataslidetypecoverpagefoursquarebuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagesvgsocialwebkittransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlay captchacontainerwrappercaptchacontainerwrapperdataslicetypealbumhover iconwrappersocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsdisclaimercontainersqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover twitchhoverlightboxcontent formwrapper plightboxinner lightboxcontent formwrapperyoutubehoveralldataslicetypesocialiconshover rdiohoverul li asqsslidewrapperdataslidetypecoverpagevideoiconstyleregulartweetavatar170ms easeoutopacity 170ms170ms easeinoutmstransitionbackgroundcoloreaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolor6pxuseiconfill1769ffsqsslidewrapperdataslidetypecoverpagestumbleuponhovericonwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons snapchatsqsslicealbumplaylist tracks trackiconwrapperborder2pxtwittergoodreadsdataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpage100ms170ms easeinoutbuttonplaypauseuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidsqsalbumminimal dataslicetypealbumdataslicetypesocialiconshover emailhovershowtracktitle sqsalbumminimal dataslicetypealbumgalleryvideobackgroundtweetdisplaynamedataslicetypesocialiconshover tidalonlysqsmodallightboxcontentshowtracktitle sqsalbumminimaldataslicetypesocialiconshover twitterdataslicetypegallerysqsalbumminimal dataslicetypealbum sqsslicealbumplaylistsocialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover vimeohoverdataslicetypesocialiconshover vscohover170ms easeinoutmoztransitionbackgroundcolordataslicetypesocialiconshover itunesdataslicetypesocialiconshover vinesocialiconssizesmallsocialiconsstylebordericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsocialiconscolorstandardsocialiconsstyleregularuseiconfill007ee5sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover fivehundredpixinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover linkedinhoveronly screendataslicetypetwitter tweetavataruseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover emailbordercolor 170msdataslicetypesocialiconshover facebookresponsivewrapperuseiconfille52d27sqsslidewrapperdataslidetypecoverpageimdbhoverdataslicetypemap gmstyleccuseiconfillae995asqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformattextualsquarespacebuttonstyleoutlinesqsmodallightboxresponsivewrapperstacked dataslicetypebuttons uldataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpageformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpageall and maxwidth600pxsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderdataslicetypesocialiconshover thedotsul5pxdataslicetypebuttons ul livevohoveruseiconfill3b5998sqsslidewrapperdataslidetypecoverpagesqsslicealbumplaylistdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpageinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactioninputtypepasswordsqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleknockoutaudioplayericonsstyleborderuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulardataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpageuseiconfill55aceesqsslidewrapperdataslidetypecoverpagefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25empstitcherdataslicetypesocialiconshover googleplayyelppasswordstyleunderlineddataslicetypesocialiconshover yelpdataslicetypenavigation ul lisqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinespansqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidflickrdataslicetypesocialiconshover rdioinputwrappernothiddenresponsivewrapperstacked sqsslicecustomformyoutubedataslicetypesocialiconshover vinehoveruseiconfill0063dcsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover fivehundredpixhovereaseinoutmoztransitioncolorautosqsslidewrapperdataslidetypecoverpagebuttontypesubmitsqsslidewrapperdataslidetypecoverpagepasswordstylerectangle dataslicetypepassworddataslicetypebuttons lieaseintransitionopacitysqsslidewrapperdataslidetypecoverpage dataslicetypecountdowndataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpageformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover bandsintownhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraisedsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinouttransitionbackgroundcolorsocialiconssizemediumsocialiconsstyleknockoutactionsnotstacked inputwrappernothiddendataslicetypesocialiconshover houzzsqsslidelayercontentdataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpageaudioplayericonsstylesolidsqsslicecustomform asqsslidewrapperdataslidetypecoverpageuseiconfill000sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons vimeoinputtypesubmitsqsslidewrapperdataslidetypecoverpageformitemsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover spotifyhoverrsshovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinefacebookhoverbandsintowninstagramdataslicetypesocialiconshover tumblrhover0sqsslidewrapperdataslidetypecoverpagedataslicetypegallerysqsgallerygrid170ms170ms easeinoutotransitionbackgroundcolorsocialiconssizemediumsocialiconsstyleborderdataslicetypealbum sqsslicealbumplaylisteaseinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesolidaudioplayericonsstyleregular2s easeinmoztransitionopacity 2siconwrapperwidth24pxheight24pxmargin0buttonshapepilldataslicetypealbumhover170ms easeinoutotransitionbackgroundcolor 170mssocialiconsstyleregularusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpageactionsstacked inputwrappericonwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover squarespacehoverinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinelayerfrontp ahoversqsslidewrapperdataslidetypecoverpagearrowiconuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsuseiconfillc41200sqsslidewrapperdataslidetypecoverpagealignmentright layerfrontspotifysocialiconsstylesolid dataslicetypesocialiconshover iconwrapperaudioplayericonsstyleborder dataslicetypealbumvscolockstyleknockout dataslicetypelockdataslicetypeheadingnotdatacompoundtypedataslicetypealbumhover iconwrapperhoverall and maxwidth1020pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover squarespacestitcherhoverinputtypesubmithoversqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactiongoodreadshoverusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialiconshover goodreadshoverdataslicetypesocialicons mediumdataslicetypesocialiconshover meetuphovereaseinout bordercolor 170mspasswordstylerectanglesocialiconssizeextralargesocialiconsstyleregulardataslicetypealbum sqsslicealbumplaylist tracksdataslicetypesocialiconshover vimeomaxwidth1020pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover reddithoverbuttonshaperoundedcornersdataslicetypebuttons ulstackeddataslicetypebodysqsslidewrapperdataslidetypecoverpage dataslicetypebodydataslicetypesocialiconshover foursquaredatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rsssvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypebodydataslicetypelockli asqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautomapstyleminimaldarkuseiconfilleb4924sqsslidewrapperdataslidetypecoverpageuseiconfill7dbb00sqsslidewrapperdataslidetypecoverpagedataslicetypebuttons2em 0pxsqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericeasesqsslidewrapperdataslidetypecoverpagesocialstacked dataslicetypesocialiconssocialiconssizemediumsocialiconsstyleregular2ssocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover behancesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylebordervimeorssdataslicetypesocialiconshover googleplayhoversqsmodallightboxopeniconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialicons youtubeflickrhoverlockstylesolideaseinmstransitionopacitydataslicetypesocialiconshover soundcloudhoversocialiconssizesmallsocialiconsstyleregulardataslicetypesocialicons twitch1dataslicetypesocialicons thedotsdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover thedotshoveruseiconfill0976b4sqsslidewrapperdataslidetypecoverpageuseiconfill8c8070sqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidcountdowncontentdataformatnumericdataslicetypesocialicons fivehundredpixfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxeaseinoutreddittwitterhoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveremailhovergooglehoverbuttonstyleoutline sqsslicecustomformgoogleaudioplayericonsstyleregular dataslicetypealbumeaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolordataslicetypesocialiconshover mediumlinkedinhoversqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypebody pinputwrapperdataslicetypesocialicons bandsintownsocialiconsstylebordersmugmugsqsslicealbumplayliststacked2s easeinmstransitionopacitydataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover flickrsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperadisplayblocksqsslidewrapperdataslidetypecoverpagedataslicetypebuttonssqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectanglegmnoprintsocialiconssizelargesocialiconsstyleregularvideoiconstyleknockouticonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidsqsalbumminimaldataslicetypesocialiconshover applepodcasthoversqsslicealbumplaylist tracksdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconssqsslidesqsslideanimationreadyeaseinouttransitionbackgroundcolor 170msdataslicetypepasswordsqsslicealbumplaylistplayinginstagramhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodysqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayaction0px 0px0ms 0mssvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypesocialiconshover behancehoverdataslicetypesocialiconshover tumblrbuttonstylesoliduseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshovericonwrapperhoverlockstylebordereaseinoutsqsslidewrapperdataslidetypecoverpageuseiconfill5adfcbsqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked dataslicetypebuttonseaseinoutmstransitionbackgroundcolor 170msdataslicetypebuttons asqsslidewrapperdataslidetypecoverpageiconwrapperwidth36pxheight36pxmargin0dataslicetypesocialicons smugmugeaseinouttransitioncolorsocialiconscolorstandardsocialiconsstyleborderdataslicetypesocialiconshover rsshoverdataslicetypesocialicons foursquaresmugmughoveruseiconfill00ab6csqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover codepenli ahoversqsslidewrapperdataslidetypecoverpagesnapchathoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutsocialiconsstyleborder dataslicetypesocialiconsuseiconfilltransparentsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineddataslicetypesocialicons twittersocialiconssizelargesocialiconsstylesolidactionsstacked inputwrappernothiddensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonsdataslicetypesocialicons vineresponsivewrapperstacked dataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpage5emfont14pxdataslicetypealbum trackprogressbaruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutlidataslicetypesocialicons applepodcastcountdowncontentdataformattextual countdownunitdataslicetypesocialiconshover applepodcastdataslicetypesocialiconshover houzzhoverdataslicetypesocialicons dribbblesqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslidein170ms easeinoutmoztransitionbackgroundcolor 170mspasswordstyleunderlined dataslicetypepasswordsqsslidewrapperdataslidetypecoverpagedataslicetypebodysqsslidewrapperdataslidetypecoverpagelightboxcontent formwrapperuseiconfille6b91esqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stumbleuponhoverdataslicetypesocialiconshover dribbblehoverdataslicetypesocialiconshover facebookhovericonwrapperlastchildsqsslidewrapperdataslidetypecoverpagecountdownunituseiconfill35465dsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons googleeaseinoutmstransitionbackgroundcolordataslicetypesocialiconshover youtubehoverdataslicetypesocialicons meetupbehancehoverdataslicetypesocialiconshover soundclouduseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversqssliceplaybuttoniconwrappermediumhover2s easeintransitionopacity 2svideoiconstylesolidsocialiconscolorstandardsocialiconsstylesolid2emsquarespacehoversocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsuseiconfillff0031sqsslidewrapperdataslidetypecoverpagetracks trackdataslicetypesocialicons emailcountdowncontentdataformattextualdataslicetypetwitternotdatacompoundtypesqsslicecustomform0pxdataslicetypecountdownmaxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypealbum sqsslicealbumplayliststackeddataslicetypealbum iconwrappersqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsalignmentright responsivewrapperstackeddataslicetypesocialiconshover redditsqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons goodreadstweettimestampmediumsocialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover mediumhovervinetwitchbuttonstyleoutlinedataslicetypesocialicons rsssqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinevideoiconstylebordersqsslidecontainernotautoimagebackgroundcolorresponsivewrapperstacked dataslicetypenavigationinputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpageeaseoutopacityeaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpageinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinerdiohoverpinterestaudioplayericonsstyleknockoutdataslicetypealbum sqsslicealbumplaylistdemoalbumshowtracktitledataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpageusemaskfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons dropboxsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinedataslicetypesocialicons rdiodataslicetypesocialicons flickr170ms easeinoutsqsslidewrapperdataslidetypecoverpageeaseintransitionopacity 2sdataslicetypesocialiconshover dropboxhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutsocialiconssizeextrasmallsocialiconsstyleregulargalleryvideobackgroundmobilesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonssqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody pbuttonstyleoutline dataslicetypebuttonsresponsivewrapperstackedtextaligncentersqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddendataslicetypesocialiconshover goodreadsdribbbledataslicetypenavigationdataslicetypesocialicons codepeneaseinout bordercolormeetupsocialiconsstyleknockoutsocialiconssizelargesocialiconsstyleborder170ms easeinouttransitionbackgroundcoloruseiconfillff4500sqsslidewrapperdataslidetypecoverpagesocialstackedtextalignleftdataslicetypesocialiconshover dropboxavisitedsqsslidewrapperdataslidetypecoverpagesqsslicecustomform spansqsslidewrapperdataslidetypecoverpagesqsslidewrapperdataslidetypecoverpage responsivewrappernotstackeddataslicetypesocialiconshover dribbblesqsmodallightboxcontent lightboxinner lightboxcontentsocialiconssizeextrasmallsocialiconsstyleborderdataslicetypesocialicons soundcloudsqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinedataslicetypesocialicons stitcherbuttonsqsslidewrapperdataslidetypecoverpagedataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpagegmstyleccfivehundredpixdataslicetypesocialiconshover vscodataslicetypesocialicons spotifydataslicetypecountdown countdowncontentdataformattextual countdownunitformwrapper pdataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolidlockstyleregularsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackeddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockout0 0sqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover smugmughoverbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypealbumsocialiconsstyleknockout dataslicetypesocialiconslockstylesolid dataslicetypelocklightboxinner lightboxcontent0mseaseinoutmstransitioncoloruseiconfill382110sqsslidewrapperdataslidetypecoverpagesocialiconssizemediumsocialiconsstylesoliduseiconfill222sqsslidewrapperdataslidetypecoverpage7pxdataslicetypesocialicons redditbuttonstyleraisedeaseinmoztransitionopacity 2s01ssocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshover60pxgithubhovertumblrhoveruseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpagesocialstackedresponsivewrappernotstackedbordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked dataslicetypenavigation ulusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedsqsmodallightboxcontent lightboxinnerstumbleuponiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidahoversqsslidewrapperdataslidetypecoverpagelightboxcontentformwrapperformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypealbum sqsslicealbumplaylistplayingdataslicetypesocialiconshover linkedin170ms easeinout bordercolordataslicetypesocialicons imdblockstyleregular dataslicetypelocksocialiconssizesmallsocialiconsstylesolidsqsslicecustomformsqsslidewrapperdataslidetypecoverpagefffsqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcolordataslicetypesocialiconshover stumbleuponmeetuphoverdataslicetypesocialiconshover tidalhoveralignmentcenteruseiconfill00b4b3sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover meetupgoogleplayasqsslidewrapperdataslidetypecoverpage14pxdataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons stumbleupondataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpageemaildataslicetypesocialiconshover codepenhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutfivehundredpixhoversqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover instagramusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover twitterhoveruseiconfill4183c4sqsslidewrapperdataslidetypecoverpageiconwrapperwidth28pxheight28pxmargin0dataslicetypealbum tracktitleusemaskfill222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover bandsintowneaseinotransitionopacitysocialiconsstylesolidscreen and maxwidth600pxsqsslidewrapperdataslidetypecoverpage1pxeaseinotransitionopacity 2s170ms easeoutopacitydataslicetypesocialicons yelpdataslicetypesocialiconshover githubhoverdataslicetypesocialicons pinterestdataslicetypegallery galleryvideobackgroundtidalhoverdataslicetypesocialiconshover flickrhoverusebackgroundfillfffsqsslidewrapperdataslidetypecoverpagedataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutdataslicetypenavigation uluseiconfill1ab7easqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover snapchathoversoundcloudhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutuseiconfillcc2127sqsslidewrapperdataslidetypecoverpageactionsstackeddropboxhoversocialstackedtextalignleft dataslicetypesocialiconsalignmentright4pxlockstyleborder dataslicetypelockdataslicetypesocialiconshover googlepinteresthoverdataslicetypesocialicons houzzdataslicetypetwitternotdatacompoundtype tweetbody3pxsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons lidropboxgoogleplayhoverdataslicetypesocialicons instagramscreendataslicetypemapbordercolorsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover imdblisqsslidewrapperdataslidetypecoverpageuseiconfill84bd00sqsslidewrapperdataslidetypecoverpagesocialiconssizesmallsocialiconsstyleknockouteaseinoutmoztransitionbackgroundcolorautoflex1snapchat

Longtail Keyword Density for Flyms.org

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
lightbox-inner lightbox-content form-wrapper14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
show-track-title sqs-album-minimal data-slice-typealbum6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
2em 0px 0px6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page6
responsive-wrapperstacked data-slice-typenavigation ul6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page5
170ms ease-outopacity 170ms5
data-slice-typenavigation ul li5
responsive-wrapperstacked data-slice-typebuttons ul5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
data-slice-typebuttons ul li4
lightbox-content form-wrapper p4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
responsive-wrapperstacked data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page3
all and max-width1020pxsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
170ms ease-in-out15
border-color 170ms15
ease-in-out border-color15
data-slice-typealbum sqs-slice-album-playlist15
data-slice-typebuttons ul14
data-slice-typegallery gallery-video-background14
lightbox-content form-wrapper14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
data-slice-typenavigation ul12
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typealbum icon-wrapper11
0 0sqs-slide-wrapperdata-slide-typecover-page11
password-style-underlined data-slice-typepassword10
data-slice-typebuttons li10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
responsive-wrapperstacked data-slice-typebuttons9
responsive-wrapperstacked data-slice-typenavigation9
password-style-rectangle data-slice-typepassword9
ul li9
170ms ease-in-outtransitionbackground-color8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
social-icons-style-solid data-slice-typesocial-iconshover8
li asqs-slide-wrapperdata-slide-typecover-page8
ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
data-slice-typebody p8
social-icons-style-border data-slice-typesocial-icons7
button-style-outlinesqs-modal-lightbox form-wrapper7
ul lisqs-slide-wrapperdata-slide-typecover-page7
show-track-title sqs-album-minimal7
button-style-outline data-compound-typepopup-overlay-action7
tracks track7
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
2em 0px6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
0px 0px6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
data-slice-typesocial-iconshover icon-wrapperhover6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
button-style-outline sqs-slice-custom-form6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
audio-player-icons-style-border data-slice-typealbum6
data-slice-typealbum track-progress-bar6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
button-style-outline data-slice-typebuttons6
data-slice-typesocial-icons email5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons dropbox5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons dribbble5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons vevo5
alignment-right responsive-wrapperstacked5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons google5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons github5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons youtube5
lock-style-regular data-slice-typelock5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
0ms 0ms5
2s 2s5
ease-outopacity 170ms5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-iconshover icon-wrapper5
data-slice-typesocial-icons bandsintown5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typesocial-icons vsco5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons behance5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
alignment-center responsive-wrapperstacked5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
data-slice-typesocial-icons codepen5
170ms ease-outopacity5
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover stitcher4
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border data-slice-typelock4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover vinehover4
actionsnotstacked input-wrappernothidden4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typetwitternotdata-compound-type tweet-body4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover snapchathover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
data-slice-typesocial-iconshover snapchat4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
form-wrapper p4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover thedotshover4
data-slice-typealbumhover icon-wrapper4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover facebook4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
social-icons-style-regular data-slice-typesocial-icons4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover rss4
svgsocial-webkit-transitionbackground-color 170ms4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover instagramhover4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
audio-player-icons-style-regular data-slice-typealbum3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
data-slice-typealbum track-title3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
lock-style-solid data-slice-typelock3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
data-slice-typealbum sqs-slice-album-playliststacked3
only screen3
data-slice-typemap gm-style-cc3
data-slice-typemap gmnoprint3
lock-style-knockout data-slice-typelock3
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
2s ease-in-moz-transitionopacity3
actionsstacked input-wrapper3
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
data-slice-typegallery gallery-video-backgroundmobile3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
ease-intransitionopacity 2s3
2s ease-intransitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-ms-transitionopacity 2s3
2s ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity 2s3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
actionsstacked input-wrappernothidden3
alignment-right layer-front3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebodysqs-slide-wrapperdata-slide-typecover-page data-slice-typebody3
data-slice-typebuttons ulstacked3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
countdown-contentdata-formattextual countdown-unit3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
p asqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitter tweet-avatar3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
social-icons-style-solid data-slice-typesocial-icons3
social-icons-style-knockout data-slice-typesocial-icons3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
2s easesqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
data-slice-typepassword arrow-icon3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page140
social-icons-color-standardsocial-icons-style-regular132
social-icons-color-standardsocial-icons-style-knockout132
data-slice-typealbum109
170ms90
data-slice-typebuttons63
data-compound-typepopup-overlay-action60
sqs-slide-containerdata-slide-typepopup-overlay55
icon-wrappersqs-slide-wrapperdata-slide-typecover-page46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page44
2s41
asqs-slide-wrapperdata-slide-typecover-page38
importantsqs-slide-wrapperdata-slide-typecover-page35
data-slice-typecountdown35
data-slice-typegallery33
responsive-wrapperstacked31
data-slice-typelock30
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
data-slice-typepassword29
form-wrapper28
sqs-album-minimal27
ul26
1s25
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
0sqs-slide-wrapperdata-slide-typecover-page24
sqs-slice-custom-form24
sqs-modal-lightbox-content24
icon-wrapper23
lightbox-inner22
data-slice-typenavigation21
li20
data-slice-typebody20
020
socialstacked20
socialstackedtext-align-left20
sqs-slide-wrapperdata-slide-typecover-page20
button-style-outline19
lightbox-content19
countdown-contentdata-formatnumeric18
sqs-slice-album-playlist17
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
tracks16
ease-in-out15
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
gallery-video-background14
p13
ahoversqs-slide-wrapperdata-slide-typecover-page13
sqs-modal-lightbox-open13
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
actionsnotstacked12
lisqs-slide-wrapperdata-slide-typecover-page12
0px12
all12
icon-wrapperhover12
social-icons-style-solid12
data-slice-typetwitter11
password-style-rectangle11
countdown-contentdata-formattextual11
password-style-underlined11
actionsstacked11
squarespace10
0ms10
max-width600pxsqs-slide-wrapperdata-slide-typecover-page10
solid10
data-slice-typetwitternotdata-compound-type10
layer-front10
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
alignment-right10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
110
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
itunes9
facebook9
pinterest9
behance9
medium9
imdb9
thedots9
fivehundredpix9
stumbleupon9
bandsintown9
stitcher9
instagram9
spotify9
tumblr9
ease-in-out-o-transitionbackground-color9
soundcloud9
email9
snapchat9
googleplay9
smugmug9
ease-in-outtransitionbackground-color9
rss9
reddit9
dropbox9
rdio9
applepodcast9
meetup9
flickr9
tidal9
linkedin9
ease-in-out-ms-transitionbackground-color9
vine9
yelp9
github9
vimeo9
goodreads9
youtube9
ease-in-out-moz-transitionbackground-color9
houzz9
vsco9
vevo9
google9
codepen9
twitter9
alignment-center9
foursquare9
dribbble9
twitch9
data-slice-typealbumhover8
ulsqs-slide-wrapperdata-slide-typecover-page8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
sqs-slice-play-buttonicon-wrapper8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
show-track-title7
social-icons-style-border7
video-icon-style-border7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
track7
data-slice-typemap7
button-style-outlinesqs-modal-lightbox7
spansqs-slide-wrapperdata-slide-typecover-page7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
input-wrappernothidden7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
sqs-slice-play-buttonicon-wrapperhover6
button-style-raised6
input-wrapper6
audio-player-icons-style-border6
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
10px6
track-progress-bar6
audio-player-icons-style-solid6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
2em6
social-icons-style-regular6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
houzzhover5
imdbhover5
instagramhover5
googlehover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
smugmughover5
ituneshover5
thedotshover5
youtubehover5
yelphover5
vscohover5
vinehover5
vimeohover5
vevohover5
twitterhover5
twitchhover5
tumblrhover5
ease-outopacity5
tidalhover5
100ms5
linkedinhover5
stumbleuponhover5
stitcherhover5
squarespacehover5
spotifyhover5
soundcloudhover5
snapchathover5
rsshover5
reddithover5
rdiohover5
meetuphover5
mediumhover5
googleplayhover5
pinteresthover5
social-icons-style-knockout5
01s5
audio-player-icons-style-regular5
applepodcasthover5
lock-style-regular5
goodreadshover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
tweet-timestamp5
bandsintownhover5
data-slice-typebodysqs-slide-wrapperdata-slide-typecover-page5
6px5
button-shape-pill5
button-shape-rounded-corners5
sqs-slice-album-playlistplaying5
gmnoprint5
gm-style-cc5
svgsocial-webkit-transitionbackground-color5
sqs-slide-layer-content5
behancehover5
dribbblehover5
emailhover5
codepenhover5
githubhover5
facebookhover5
foursquarehover5
dropboxhover5
flickrhover5
fivehundredpixhover5
4px4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
max-width1020pxsqs-slide-wrapperdata-slide-typecover-page4
track-title4
5px4
ulstacked4
map-style-minimal-dark4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-regular4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
data-slice-typeheadingnotdata-compound-type4
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
displaytablesqs-slide-wrapperdata-slide-typecover-page4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-solid4
audio-player-icons-style-knockout4
lock-style-border4
icon-wrapperwidth24pxheight24pxmargin04
tweet-body4
responsive-wrapperstackedtext-align-center3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
actionssqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
data-slice-typegallerysqs-gallery-grid3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
responsive-wrapper3
disclaimer-containersqs-slide-wrapperdata-slide-typecover-page3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containernotauto-image-background-color3
autosqs-slide-wrapperdata-slide-typecover-page3
1px3
video-icon-style-knockout3
button-style-solid3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
countdown-unit3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
ease-in-outtransitioncolor3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
ease-in-out-o-transitioncolor3
captcha-container-wrapper3
responsive-wrappernotstacked3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
ease-in-out-ms-transitioncolor3
5emfont14px3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
autoflex13
60px3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
lock-style-solid3
fffsqs-slide-wrapperdata-slide-typecover-page3
lock-style-knockout3
sqs-slidesqs-slide-animation-ready3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
ease-in-out-moz-transitioncolor3
sqs-slice-album-playliststacked3
ease-in-moz-transitionopacity3
social-icons-size-smallsocial-icons-style-solid3
8px3
social-icons-size-extra-largesocial-icons-style-regular3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-regular3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
social-icons-size-largesocial-icons-style-border3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-border3
social-icons-size-extra-largesocial-icons-style-knockout3
social-icons-size-extra-largesocial-icons-style-solid3
social-icons-size-largesocial-icons-style-regular3
social-icons-size-smallsocial-icons-style-regular3
use-iconfill000sqs-slide-wrapperdata-slide-typecover-page3
tweet-display-name3
screen3
sqs-slice-album-playlistdemo-album3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
button-play-pause3
7px3
sqs-modal-lightbox3
icon-wrapperwidth36pxheight36pxmargin03
tweet-avatar3
tweet-handle3
3px3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth32pxheight32pxmargin03
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
easesqs-slide-wrapperdata-slide-typecover-page3
arrow-icon3
14px3
icon-wrapperwidth28pxheight28pxmargin03
social-icons-size-extra-smallsocial-icons-style-regular3
icon-wrapperborder2px3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
ease-in-ms-transitionopacity3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
only3
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
ease-in-o-transitionopacity3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
gallery-video-backgroundmobile3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
ease-intransitionopacity3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3

Flyms.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Flyms.org is a scam?

Websites with Similar Names

Flyms.com
South32.net
Flyms.org
Fly for MS 20,000 mile flight
Flymsy.com
Official Home - Louis Armstrong New Orleans International Airport

Recently Updated Websites

Thebetterpetbowl.com 2 seconds ago.Solarpassion.com 2 seconds ago.Unzippedtv.com 3 seconds ago.Eliav-brand.com 4 seconds ago.Nasalou.com 4 seconds ago.Ehliens.com 4 seconds ago.Dropchange.org 5 seconds ago.Threehoodoosisters.com 5 seconds ago.Textboox.com 5 seconds ago.Rocksnstocks.com 6 seconds ago.Newtownproject.com.au 6 seconds ago.Pinkbeautycosmetics.com 6 seconds ago.Nutritionstyles.com 6 seconds ago.Pbrefacing.com 7 seconds ago.Cartim.pl 7 seconds ago.Dellso2worldwide.com 8 seconds ago.Socomcomputers.com 8 seconds ago.Rawheatplumbing-peterborough.co.uk 8 seconds ago.Social-team.com 8 seconds ago.Officeboosters.com 9 seconds ago.Yeswep.com 9 seconds ago.Thehairlabsalon.com 9 seconds ago.Waterzuivering.org 9 seconds ago.Beatrising.com 10 seconds ago.Tommyberg.com 11 seconds ago.Yournetcommunications.net 11 seconds ago.Blogsbrasil.com.br 11 seconds ago.Yons.ru 11 seconds ago.Cth315.com 12 seconds ago.Colorlifebuy.com 12 seconds ago.