Follownet.pl Favicon Follownet.pl

Follownet.pl Website Thumbnail
Checking...
Tani hosting bez limitu transferu :: Certyfikaty SSL :: Domeny :: Follownet.pl
Low trust score
Last updated:2020-10-22
Internet and Telecom > Web Hosting
Tani hosting bez limitu transferu, domeny oraz najtańsze certyfikaty SSL.


Domain summary

Domain label
follownet
Domain extension
pl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is follownet.pl ranked relative to other sites:

Percentage of visits to follownet.pl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Follownet.pl registered?
A: Follownet.pl was registered 1 month, 1 day, 17 hours, 7 minutes, 59 seconds ago on Thursday, October 22, 2020.
Q: When was the WHOIS for Follownet.pl last updated?
A: The WHOIS entry was last updated 1 month, 1 day, 17 hours, 7 minutes, 59 seconds ago on Thursday, October 22, 2020.
Q: What are Follownet.pl's nameservers?
A: DNS for Follownet.pl is provided by the following nameservers:
  • ns2.follownet.pl
Q: Who is the registrar for the Follownet.pl domain?
A: The domain has been registered at NASK.
Q: What is the traffic rank for Follownet.pl?
A: Follownet.pl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Follownet.pl each day?
A: Follownet.pl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Follownet.pl resolve to?
A: Follownet.pl resolves to the IPv4 address 91.198.137.177.
Q: In what country are Follownet.pl servers located in?
A: Follownet.pl has servers located in the Germany.
Q: What webserver software does Follownet.pl use?
A: Follownet.pl is powered by Nginx webserver.
Q: Who hosts Follownet.pl?
A: Follownet.pl is hosted by S-NET Sp. z o.o. in Germany.
Q: How much is Follownet.pl worth?
A: Follownet.pl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Follownet.pl?

Follownet.pl Hosting Provider Information

Hosted IP Address:91.198.137.177
Hosted Hostname:srv.xlb.pl
Service Provider:S-NET Sp. z o.o.
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "S-NET Sp. z o.o." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
S-NET Sp. z o.o.
0.0014%

HTTP Header Analysis for Follownet.pl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Thu, 22 Oct 2020 09:32:01 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://www.follownet.pl/

Follownet.pl Domain Nameserver Information

HostIP AddressCountry
ns2.follownet.pl 91.121.167.134France France


Need to find out who hosts Follownet.pl?


Domain Registration (WhoIs) information for Follownet.pl

 request limit exceeded 

Follownet.pl Free SEO Report

Website Inpage Analysis for Follownet.pl

H1 Headings

1 :
  1. follownetZaufaj nam, działamy na rynku od 10 lat!

H2 Headings

2 :
  1. Pomożemy Ci,rozkręcić własny biznes.Zacznij od domeny od 10zł.
  2. Będziesz zadowolony.Jak inni. Dołącz do nich.

H3 Headings

3 :
  1. Serwery WWWWirtualne miejsce na Twoje dane
  2. Certyfikaty SSLZabezpiecz swoją stronę WWW
  3. Serwery dedykowaneMaszyny dla wymagających

H4 Headings

2 :
  1. Co możemy Ci zaoferować?
  2. Zaufaj naszemu doświadczeniu

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Follownet.pl

zobaczhostingwicejzobacz wicejserwerycenacertyfikatysprawdnacena odcertyfikaty ssldomenysslod0

Longtail Keyword Density for Follownet.pl

KeywordsOccurences
certyfikaty ssl3
cena od3
zobacz wicej3
od8
serwery6
domeny5
hosting4
certyfikaty4
na3
03
ssl3
sprawd3
cena3
zobacz3
wicej3

Follownet.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Follo-futura.no
Follo Futura
Follo-wings.com
Coming Soon - Future home of something quite cool
Follo.co.in
Follo Your Fev Star - Biography of Stars
Follo.ooo
follo.ooo Coming Soon
Follo3me.com
隨我行 FolloMe|行山路線 ‧ 資訊
Folloder.com
folloder.com
Follodo.xyz
jobpostingschicago.com :: Home
Follodomon.com
Важно

Recently Updated Websites

Cultofcinema.com 5 seconds ago.Vacavalleyvettes.com 7 seconds ago.Alseda.by 9 seconds ago.Chessvin.org.ua 12 seconds ago.Ccfcasia.com 12 seconds ago.Avto-kruiz.com 12 seconds ago.Cava.cool 12 seconds ago.Provincialrealty.ca 16 seconds ago.Dorami.com.ua 16 seconds ago.Energo-sun.com.ua 17 seconds ago.Deti-sevastopol.ru 18 seconds ago.Namduoclinhchi.com 19 seconds ago.Balkanex.tk 20 seconds ago.Carfinder.ua 22 seconds ago.Paliumtrainings.biz 22 seconds ago.Loveyulu.com 22 seconds ago.Harmonytherayoga.com 23 seconds ago.Deal-big.ru 23 seconds ago.810-462.com 25 seconds ago.Chuguev-raiono.gov.ua 26 seconds ago.Bolahost.com 27 seconds ago.Camomille.com.ua 28 seconds ago.Alimuzika.com 28 seconds ago.Bses.in.ua 28 seconds ago.Dolina-gryoz.com.ua 29 seconds ago.Mygasindia.in 29 seconds ago.Dossodossidowntown.com 29 seconds ago.Hyogo-yane.com 30 seconds ago.Mountainclubtreks.com 31 seconds ago.Bitbon.io 32 seconds ago.