Summary  |  Free home delivery and take away from 4000+ Restaurants in India. 30% discount voucher code | Order food online or via Mobile App
Low trust score  | 
None has a Low Trust Score, and a Statvoo Rank of G. is hosted by CloudFlare, Inc. in Singapore, Singapore, Singapore, 179431. has an IP Address of and a hostname of

The domain was registered 7 years 11 months 2 weeks ago by , it was last modified 5 years 3 months 3 weeks ago and currently is set to expire 3 years 11 months 2 weeks ago.

Whois information for

Full Whois Lookup for Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D5770341-AFIN
Created On:28-Jan-2012 06:08:08 UTC
Last Updated On:28-Jan-2017 22:32:17 UTC
Expiration Date:28-Jan-2018 06:08:08 UTC
Sponsoring Registrar:InterNetX GmbH (R43-AFIN)
Registrant ID:INX-15444541
Registrant Name:Benjamin Bauer
Registrant Organization:Foodpanda GmbH
Registrant Street1:Schreiberhauer Str. 30
Registrant Street2:
Registrant Street3:
Registrant City:Berlin
Registrant State/Province:DE
Registrant Postal Code:10317
Registrant Country:DE
Registrant Phone:+49.30300131835
Registrant Phone Ext.:
Registrant FAX:+49.30300131899
Registrant FAX Ext.:
Registrant Login to show email
Admin Name:Benjamin Bauer
Admin Organization:Foodpanda GmbH
Admin Street1:Schreiberhauer Str. 30
Admin Street2:
Admin Street3:
Admin City:Berlin
Admin State/Province:DE
Admin Postal Code:10317
Admin Country:DE
Admin Phone:+49.30300131835
Admin Phone Ext.:
Admin FAX:+49.30300131899
Admin FAX Ext.:
Admin Login to show email
Tech Name:Benjamin Bauer
Tech Organization:Foodpanda GmbH
Tech Street1:Schreiberhauer Str. 30
Tech Street2:
Tech Street3:
Tech City:Berlin
Tech State/Province:DE
Tech Postal Code:10317
Tech Country:DE
Tech Phone:+49.30300131835
Tech Phone Ext.:
Tech FAX:+49.30300131899
Tech FAX Ext.:
Tech Login to show email
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:CloudFlare, Inc.
Hosted Country:SingaporeSG
Location Latitude:1.28967
Location Longitude:103.85
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: cloudflare-nginx
Date: Tue, 09 Jun 2015 18:09:10 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=0, private
Vary: Accept-Encoding
X-UA-Compatible: IE=Edge,chrome=1
CF-RAY: 1f3ec93479bf02fd-LHR
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

food onlinemumbaifeatureonlineourpickandroidcuisinesplacehyderabadprivacy policyconditions privacy policyfood deliveryenjoy foodfoodconditions privacycanfavoriterestaurantspaymentallfoodpanda apptermsdeliversimplegurgaonpopularrestaurantyou canprivacyindiantypethousandsnavidelhifastyourcityavailablecakespizzawebsitethanorder food onlinestepsfreetoporderingdoofferspune2enjoysign up1orderorder foodupservicebangaloreterms and conditionswaydealsgetapphavefindindiaconditionsnear youkolkatacorporateonline ordervegetarianpolicylikeeasyphonenbsponechennaipunjabimakesigndeliveryweusyoucities0ordering foodbiryanidessertsnearpayioshelpanyfoodpandamostbestice

Longtail Keyword Density for

terms and conditions4
order food online3
conditions privacy policy3
food online8
order food5
near you4
privacy policy4
foodpanda app4
you can4
food delivery4
sign up3
online order3
conditions privacy3
enjoy food3
ordering food3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?