| | F1 News Formula Uno | Gran Premi Formula 1
Low trust score  | F1 News Formula Uno Gran Premi Formula 1 Orari Televisione Circuiti Meteo Team Piloti Calendario Gare Ferrari McLaren Mercedes Red Bull Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:34,081
Majestic Rank Majestic Rank:480,327
Domain Authority Domain Authority:27%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: IT-Nic
Expiration Date:2016-03-28  3 years 1 month 3 weeks ago

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

* Please note that the following result could be a subgroup of *
* the data contained in the database. *
* *
* Additional information can be visualized at: *
* *

Status: clientDeleteProhibited
Created: 2013-03-28 20:16:18
Last Update: 2017-05-30 12:10:13
Expire Date: 2018-03-28

Organization: s.r.l.

Admin Contact
Name: Vittorio Azzano
Organization: s.r.l.

Technical Contacts
Name: Vittorio Azzano
Organization: s.r.l.

Organization: OVH


Who hosts is hosted by Rackspace Hosting in Michigan, Lansing, United States, 48917. has an IP Address of and a hostname of and runs Apache/2.4 web server. Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:42.7257
Location Longitude:-84.636
Webserver Software:Apache/2.4

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache/2.2
Vary: Accept-Encoding,Cookie,User-Agent
Cache-Control: max-age=3, must-revalidate
Content-Type: text/html; charset=UTF-8
WP-Super-Cache: Served supercache file from PHP
Content-Encoding: gzip
Date: Sun, 21 Jun 2015 18:34:33 GMT
Connection: Keep-Alive
Last-Modified: Sun, 21 Jun 2015 18:22:42 GMT
Content-Length: 35285

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

diastplmathrandom 0xffffffffspagran bretagna1eid windowmaurogiorni fa28dopo il granoreenglish f1kimi raikkonenbelgio 2017clicca qui pertoro rossoleilifprivacyokdelaustraliapilotifpfp english f1giornistagione 2017 1261922team 1 giornofunctionclassifica del mondiale20giorni fa f1torostagionerassegnaal23winastagq winastagqprospettivagiornofunctionwin vartrueyamahaoraribmwiannoneformula e9fp englishbelgiogiorno famainconfiginittimenewfpradioit16gp belgio25clicca qui30altrimotoriper ilcalendario motogprallycostruttori6rosbergdella stagionealla8daifprivacyok functionwingran premioconfuorimclarenquiwinastagqmainpushfunctionscopeqobjq qtagaddplacementstagione 2017raikkonenperlautokimiastplmathrandom 0xffffffff documentwrite1 giorno fa0xffffffff documentwrite winastagq102017 orari circuitocalendario0xffffffffrinnovo21fa motogpdopo ilil gran premiorassegna 2 giorni0eid astplmathrandom 0xffffffffwsbkdel mondialewinastagq winastagq mainconfiginittimenewteam 1verstappenrassegna 2dategettime winastagqmainpushfunctionscopeqobjqspeciali13mondialedategettime11finishsessionmotorassegnavandoornegp belgio 2017rdocumentwrite winastagq1 giorno53winastagqcliccaenglishwinastagq mainconfiginittimenewtimemotogp27292 giorni fagpdategettime winastagqmainpushfunctionscopeqobjq qtagaddplacementkawasakimiscellaneadellafunctionwin var eidwindowfunctionwinore faimolaqui per24152017 oraribretagna18eid astplmathrandomdataitaliatelevisionecircuitoowinastagq mainconfiginittimenew dategettimeclassifica del4ore fa f1splashlibereducatieclassificagran14premioapriliail granf1documentwrite winastagq winastagqvar eidsilverstonepaoloil calendarioagosto0xffffffff documentwriteorari circuitofaeidmisanogiorno fa f1qtagaddplacementdella stagione 2017varleclerchondasennafa f1mainconfiginittimenew dategettime winastagqmainpushfunctionscopeqobjq2giorno fa motogp2 giorni2017 1dopo17ferrariwinastagqmainpushfunctionscopeqobjqifprivacyok functionwin varmondiale pilotispagnaprovaindycarrossonewmondiale costruttoriwrcvar eid astplmathrandom7pistajdocumentwriteformulatopteammainconfiginittimenew dategettime12facebookastplmathrandom

Longtail Keyword Density for

1 giorno fa14
ore fa f113
fp english f17
giorno fa f16
2 giorni fa6
team 1 giorno5
giorni fa f15
della stagione 20174
functionwin var eid4
il gran premio4
stagione 2017 14
dategettime winastagqmainpushfunctionscopeqobjq qtagaddplacement4
astplmathrandom 0xffffffff documentwrite4
eid astplmathrandom 0xffffffff4
var eid astplmathrandom4
0xffffffff documentwrite winastagq4
documentwrite winastagq winastagq4
mainconfiginittimenew dategettime winastagqmainpushfunctionscopeqobjq4
winastagq mainconfiginittimenew dategettime4
winastagq winastagq mainconfiginittimenew4
dopo il gran3
clicca qui per3
classifica del mondiale3
gp belgio 20173
2017 orari circuito3
ifprivacyok functionwin var3
giorno fa motogp3
rassegna 2 giorni3
ore fa26
fa f124
giorno fa14
1 giorno14
fp english10
english f17
2 giorni6
gran premio6
giorni fa6
gran bretagna5
fa motogp5
stagione 20175
mondiale piloti5
team 15
della stagione4
mondiale costruttori4
il gran4
del mondiale4
2017 14
documentwrite winastagq4
eid window4
var eid4
eid astplmathrandom4
0xffffffff documentwrite4
winastagq winastagq4
winastagq mainconfiginittimenew4
winastagqmainpushfunctionscopeqobjq qtagaddplacement4
dategettime winastagqmainpushfunctionscopeqobjq4
functionwin var4
mainconfiginittimenew dategettime4
astplmathrandom 0xffffffff4
classifica del3
dopo il3
qui per3
clicca qui3
kimi raikkonen3
formula e3
per il3
gp belgio3
belgio 20173
ifprivacyok functionwin3
orari circuito3
toro rosso3
calendario motogp3
il calendario3
2017 orari3
rassegna 23

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?