Fragrantica.ru  |  Парфюмерный журнал, Парфюмерная энциклопедия, Описание ароматов и Online сообщество фрагрантика - Fragrantica.ru
Low trust score  | 



Fragrantica.ru Website Information

Website Ranks & Scores for Fragrantica.ru

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:16,027
Majestic Rank Majestic Rank:254,564
Domain Authority Domain Authority:39%
DMOZ DMOZ Listing:No

Whois information for fragrantica.ru

Full Whois Lookup for Fragrantica.ru Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Fragrantica.ru. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: FRAGRANTICA.RU
nserver: greg.ns.cloudflare.com.
nserver: ivy.ns.cloudflare.com.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2008-01-27T21:00:00Z
paid-till: 2018-01-27T21:00:00Z
free-date: 2018-02-28
source: TCI

Last updated on 2017-08-30T11:31:31Z

Who hosts Fragrantica.ru?

Fragrantica.ru is hosted by CloudFlare, Inc. in California, Los Angeles, United States, 90001.
Fragrantica.ru has an IP Address of 190.93.240.123 and a hostname of 190.93.240.123.



Fragrantica.ru Web Server Information

Hosted IP Address:190.93.240.123
Hosted Hostname:190.93.240.123
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:34.0522
Location Longitude:-118.244
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Fragrantica.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 17 Jun 2015 00:27:13 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cf-Railgun: direct (starting new WAN connection)
Expires: Fri, 25 Aug 1972 10:30:00 GMT
Last-Modified: Wed, 17 Jun 2015 00:27:12 GMT
Vary: Accept-Encoding
X-Powered-By: PHP/5.4.38
Server: cloudflare-nginx
CF-RAY: 1f7aa099a47d06c4-LHR
Content-Encoding: gzip


Need to find out who hosts Fragrantica.ru?

Fragrantica.ru Free SEO Report

Website Inpage Analysis for Fragrantica.ru

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Fragrantica.ru

nbspnbsp nbspnbsp nbspnbspsubnavfunction returnbrocardnoirknightnbspnbspguerlain082917musbahsmartal musbahsmartlesgold007iflangaattrhref functionmuskroger amproger082417bondnbspnbsp nbspnbspreturnbond 007aattrhref function returnfunctionnewsubnav aattrhref function0fragranticasubnav aattrhrefaattrhrefalterryvaramp

Longtail Keyword Density for Fragrantica.ru

KeywordsOccurences
aattrhref function return19
subnav aattrhref function19
nbspnbsp nbspnbsp nbspnbsp5
aattrhref function19
function return19
subnav aattrhref19
nbspnbsp nbspnbsp7
roger amp5
al musbahsmart4
bond 0073
al23
function20
subnav19
iflang19
aattrhref19
return19
nbspnbsp9
amp5
gold5
roger5
guerlain4
var4
musbahsmart4
04
musk4
fragrantica4
les3
noir3
0829173
knight3
bond3
0073
0824173
terry3
brocard3
new3

What are the nameservers for fragrantica.ru?

Fragrantica.ru Domain Nameserver Information

HostIP AddressCountry
greg.ns.cloudflare.com 173.245.59.115United States United States
ivy.ns.cloudflare.com 173.245.58.120United States United States

Fragrantica.ru DNS Record Analysis DNS Lookup

HostTypeTTLExtra
fragrantica.ruA286IP: 190.93.240.123
fragrantica.ruA286IP: 190.93.243.123
fragrantica.ruA286IP: 190.93.242.123
fragrantica.ruA286IP: 190.93.241.123
fragrantica.ruA286IP: 141.101.123.123
fragrantica.ruNS86400Target: ivy.ns.cloudflare.com
fragrantica.ruNS86400Target: greg.ns.cloudflare.com
fragrantica.ruSOA86400MNAME: greg.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2018567156
Refresh: 10000
Retry: 2400
Expire: 604800
fragrantica.ruMX300Priority: 10
Target: mail.fragrantica.ru
fragrantica.ruAAAA286IPV6: 2400:cb00:2048:1::be5d:f37b
fragrantica.ruAAAA286IPV6: 2400:cb00:2048:1::8d65:7b7b
fragrantica.ruAAAA286IPV6: 2400:cb00:2048:1::be5d:f17b
fragrantica.ruAAAA286IPV6: 2400:cb00:2048:1::be5d:f27b
fragrantica.ruAAAA286IPV6: 2400:cb00:2048:1::be5d:f07b

Alexa Traffic Rank for Fragrantica.ru


Alexa Search Engine Traffic for Fragrantica.ru