Frankiermaschinen | Falzmaschinen | elektr. Brieföffner

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-27
Category: This site has not been categorized yet

Vertrieb und Service von Postbearbeitungsmaschinen wie z.B. elektrische Brieföffner, Frankiermaschinen und Falzmaschinen für versch. Postvolumen.


Domain summary

Domain label
frankiersysteme
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is frankiersysteme.de ranked relative to other sites:

Percentage of visits to frankiersysteme.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Frankiersysteme.de registered?
A: Frankiersysteme.de was registered 4 months, 1 week, 2 days, 12 hours, 43 minutes, 1 second ago on Tuesday, October 27, 2020.
Q: When was the WHOIS for Frankiersysteme.de last updated?
A: The WHOIS entry was last updated 3 years, 8 months, 5 days, 12 hours, 43 minutes, 1 second ago on Friday, June 30, 2017.
Q: What are Frankiersysteme.de's nameservers?
A: DNS for Frankiersysteme.de is provided by the following nameservers:
  • ns1.timmehosting.de
  • ns2.timmehosting.de
  • ns3.timmehosting.de
Q: Who is the registrar for the Frankiersysteme.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Frankiersysteme.de?
A: Frankiersysteme.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Frankiersysteme.de each day?
A: Frankiersysteme.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Frankiersysteme.de resolve to?
A: Frankiersysteme.de resolves to the IPv4 address 138.201.14.224.
Q: In what country are Frankiersysteme.de servers located in?
A: Frankiersysteme.de has servers located in the Germany.
Q: What webserver software does Frankiersysteme.de use?
A: Frankiersysteme.de is powered by Nginx webserver.
Q: Who hosts Frankiersysteme.de?
A: Frankiersysteme.de is hosted by Hetzner Online GmbH in Germany.
Q: How much is Frankiersysteme.de worth?
A: Frankiersysteme.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Frankiersysteme.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Frankiersysteme.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Frankiersysteme.de

H1 Headings

1 :
  1. Frankiermaschinen und Brieföffner von A&B Bürokommunikation

H2 Headings

9 :
  1. Willkommen bei A&B Bürokommunikation in Langenhagen bei Hannover 
  2. Brieföffner FRAMA Access B300
  3. Brieföffner FRAMA Access B400
  4. Briefschließer Mercure Taurus C mit elektronischen Stückzähler
  5. Falzmaschine FRAMA Folder P900 A plus (automatisch)
  6. Falzmaschine FRAMA Folder P900-S
  7. Falzmaschine IDEAL 8306 / 83060011
  8. Frankiermaschine Frama Matrix F82
  9. Kuvertiermaschine FRAMA Mailer C400i-2/1

H3 Headings

5 :
  1. Frama Matrix F12
  2. Frama Mailer
  3. Frama Matrix F62
  4. Frama P900
  5. Ihr Spezialist für Postbearbeitung (z.B. Frankiermaschinen, Falzmaschinen und vieles mehr)

H4 Headings

6 :
  1. 1. Postbearbeitungsgeräte
  2. 2. Betreuung Ihrer EDV-Hardware und Software
  3. 3. Auch wichtig: Geld zählen und prüfen
  4. 4. Verbrauchsmaterial wie Tinte und Toner
  5. 5. Fordern Sie unseren Bürokatalog an!
  6. Haben Sie weitere Fragen an uns?

H5 Headings

4 :
  1. Postbearbeitungsgeräte vereinfachen Ihr Büroleben
  2. Frankiermaschinen mit Touchscreens
  3. Möchten Sie sich unsere Postbearbeitungsgeräte einmal ansehen?
  4. Für Sie in der Region Hannover unterwegs

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

21 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

108:

Links - Internal (nofollow)

0:

Keyword Cloud for Frankiersysteme.de

sie unsbuumlrokommunikationarbeitenmelden sie sichegalaampbrufen sie unsfrankiermaschineuumlber unsersolltenunserenbriefffnerimgeraumltenjqueryslideshownewproductskoumlnnen wirihnenderunserebekommenodernbsp nbsp nbsprufen sietonermoumlchteneinemeldenfalzmaschinefuumlrfuumlr ihreihrdetailansichtframa matrixihremfindenfrankiermaschinen mitndashunskuvertiermaschinennutzen sieunserverbrauchsmaterialdetailansicht falzmaschineversandkostensichanbietenuumlberfragen zukaufenden0steuerngelddesdiesesteuern zzgl versandkostennbsp nbspdannihrezu0511 97329790datenschutzfragennovastortelefon 0511frzzgl versandkostennachsteuern zzglwenn sieauchfunctiondassistsind0511frankiermaschinenmehrservicenichthierproduktekontaktformularpostbearbeitungsgeraumlteeseinunseremnbspartikelmithabeninkl steuernmatrixkoumlnnenegal obinkl steuern zzglsieumfalzmaschinenbeidasvonversandkosten detailansichthaben siezzgl steuernihrerversandkosten detailansicht falzmaschinetelefonaampb buumlrokommunikationverbauchsmaterial framaframadurch diewieobaufzeitfrankiersystemefuumlr sienutzendurchzzglwirsie sichgerneschonverbauchsmaterialbei unszzgl versandkosten detailansichtinkleinendruckerdietelefon 0511 97329790wennbekommen sienicht findeneinfachsoftwaremelden sienochrufenkatalog

Longtail Keyword Density for Frankiersysteme.de

KeywordsOccurences
zzgl versandkosten detailansicht8
inkl steuern zzgl7
steuern zzgl versandkosten7
telefon 0511 973297905
melden sie sich4
rufen sie uns3
versandkosten detailansicht falzmaschine3
nbsp nbsp nbsp3
versandkosten detailansicht8
sie sich8
zzgl versandkosten8
inkl steuern8
zzgl steuern8
steuern zzgl7
bei uns6
0511 973297906
fuumlr sie5
telefon 05115
nbsp nbsp4
haben sie4
frama matrix4
egal ob4
sie uns4
melden sie4
aampb buumlrokommunikation4
wenn sie3
fragen zu3
frankiermaschinen mit3
durch die3
nutzen sie3
fuumlr ihre3
bekommen sie3
koumlnnen wir3
rufen sie3
uumlber unser3
nicht finden3
detailansicht falzmaschine3
verbauchsmaterial frama3
sie62
wir22
frama21
die20
zu18
steuern16
zzgl16
fuumlr15
uns15
auch13
der13
software13
frankiermaschinen13
sich12
oder12
bei11
mit11
von11
nbsp10
uumlber9
ist9
versandkosten9
koumlnnen9
ihnen9
dann9
haben9
den8
ein8
inkl8
detailansicht8
nicht8
sind7
diese7
07
mehr6
ihr6
05116
telefon6
gerne6
aampb6
finden6
unsere6
es6
hier6
um6
kontaktformular5
fragen5
geld5
das5
produkte5
im5
falzmaschinen5
ihre5
auf4
ihrem4
arbeiten4
wenn4
nutzen4
artikel4
wie4
briefffner4
geraumlten4
egal4
ob4
eine4
einfach4
des4
bekommen4
ndash4
kaufen4
matrix4
unser4
buumlrokommunikation4
melden4
kuvertiermaschinen4
moumlchten3
unseren3
toner3
verbauchsmaterial3
postbearbeitungsgeraumlte3
fr3
anbieten3
function3
verbrauchsmaterial3
zeit3
katalog3
falzmaschine3
unserem3
drucker3
dass3
ihrer3
durch3
service3
novastor3
einen3
sollten3
nach3
rufen3
schon3
datenschutz3
frankiersysteme3
noch3
frankiermaschine3
jqueryslideshownewproducts3

Who hosts Frankiersysteme.de?

Frankiersysteme.de Hosting Provider Information

Hosted IP Address:138.201.14.224
Hosted Hostname:ip138-201-14-224.timmeserver.de
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Hetzner Online GmbH
1.2092%

HTTP Header Analysis for Frankiersysteme.de

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Tue, 27 Oct 2020 11:46:00 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://www.frankiersysteme.de/

Frankiersysteme.de Domain Nameserver Information

HostIP AddressCountry
ns1.timmehosting.de 176.9.231.105
ns2.timmehosting.de 88.198.243.135
ns3.timmehosting.de 144.76.152.215


Need to find out who hosts Frankiersysteme.de?


Domain Registration (WhoIs) information for Frankiersysteme.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: frankiersysteme.de
Nserver: ns1.timmehosting.de
Nserver: ns2.timmehosting.de
Nserver: ns3.timmehosting.de
Status: connect
Changed: 2017-06-30T16:59:11+02:00

Websites with Similar Names

Frank-1nfo.site
frank-1nfo.site удален - 01:19:42 18.01.21
Frank-academy.de
Exzellenz - Frank Academy
Frank-albig.de
Wasserstrahlschneiden,Maschinenbau | Günther Frank GmbH
Frank-and-christy.com
Squarespace - Website Expired
Frank-and-joes-harmon-deli.com
Frank & Joe's Harmon Deli is OPEN!! - Frank & Joes Harmon Deli, Croton-on-Hudson NY
Frank-and-monica.com
frank-and-monica.com is coming soon
Frank-anita.de
Horoskope, private Astrologie-Hilfe ULB im Internet by Harald Frank

Recently Updated Websites

1200whuntington32.com (1 second ago.)Hindixxxstory.xyz (1 second ago.)Cullgame.com (1 second ago.)Indiatube.net (1 second ago.)Quarantineboo.online (2 seconds ago.)Sandinski.com (2 seconds ago.)Leyu1727.app (2 seconds ago.)Makemoneyfree.online (2 seconds ago.)Recambiosymas.com (2 seconds ago.)Globallogisticsandsupplychainmanagement.com (3 seconds ago.)Connex.associates (3 seconds ago.)Vanzan.club (3 seconds ago.)Kellycoffeebar.com (4 seconds ago.)Urbanpleinair.com (4 seconds ago.)Masterspgschool.org (4 seconds ago.)Bbwgirls.date (4 seconds ago.)Octomass.com (5 seconds ago.)Realhistory.us (5 seconds ago.)Beverlyhillsbitcoin.club (6 seconds ago.)Bs-danaya.com.ua (6 seconds ago.)Aoabet5173.com (6 seconds ago.)Missmilano.com (6 seconds ago.)Hondagrancanaria.com (7 seconds ago.)Weag.app (7 seconds ago.)Spaspaceapp.us (7 seconds ago.)Michaelhoelscher.com (7 seconds ago.)Busybeavers.rocks (8 seconds ago.)Redrock.farm (8 seconds ago.)Hqbet1338.vip (8 seconds ago.)Bondsfornonprofits.com (8 seconds ago.)

Recently Searched Keywords

gebruikte (1 second ago.)выражаем надежду на дальнейшее плодотворное сотрудничество и желаем успехов в работе! (1 second ago.)du compte (2 seconds ago.)ali keshavaz (2 seconds ago.)so you can (3 seconds ago.)airlock dalam paip (3 seconds ago.)nu mng (4 seconds ago.)calabria classica (6 seconds ago.)50 margin (6 seconds ago.)икмо краснодар (9 seconds ago.)rtd probes (10 seconds ago.)48 49 (12 seconds ago.)headshoots (12 seconds ago.)usdgroupnameeventbriteservicefeebaseitemnet-includablerulefeenameeventbriteservicefeepayerattendeetitleeventbrite (13 seconds ago.)云计算 (14 seconds ago.)nose ring (15 seconds ago.)108 21:04 young thai student teen fuck after college by big dick guy (17 seconds ago.)nega (19 seconds ago.)utilizare raze x in scop diagnostic (20 seconds ago.)cornerstonerockymountainregion (22 seconds ago.)thanksgiving for your (22 seconds ago.)sexual dysfunction (24 seconds ago.)science experiments (29 seconds ago.)pedia (31 seconds ago.)dixie division mv club (32 seconds ago.)trusted pharmacy (33 seconds ago.)ukry e (34 seconds ago.)lending kv real (37 seconds ago.)teacup (39 seconds ago.)hans lambermont (42 seconds ago.)