Favicon Website Thumbnail
Flytt och rengöring helt enkelt
Low trust score
Add a review Change category Claim this site
Vi samlar Sveriges bästa flyttföretag och städföretag så att du kan få information och rätt fakta på ett ställe. Var aldrig mer osäker.

Domain summary

Domain label
Domain extension
Domain registered:
Domain updated:
Domain expires:
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 1 year, 4 weeks, 2 days, 21 hours, 58 minutes, 1 second ago on Thursday, August 29, 2019.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 2 weeks, 5 days, 21 hours, 58 minutes, 1 second ago on Wednesday, September 9, 2020.
Q: Who is the registrar for the domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for
A: has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit each day?
A: receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the Sweden.
Q: What webserver software does use?
A: is powered by Apache/2.4.18 (Ubuntu) webserver.
Q: Who hosts
A: is hosted by Mainloop Solutions AB in Sweden.
Q: How much is worth?
A: has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Mainloop Solutions AB
Hosted Country:SwedenSE
Location Latitude:59.3247
Location Longitude:18.056
Webserver Software:Apache/2.4.18 (Ubuntu)

Is "Mainloop Solutions AB" in the Top 10 Hosting Companies?


HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 09 Sep 2020 18:21:40 GMT
Server: Apache/2.4.18 (Ubuntu)
Last-Modified: Mon, 03 Aug 2020 09:07:59 GMT
ETag: "1f93-5abf579a713ae-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 3286
Content-Type: text/html Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

WhoIs information for

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
state: active
holder: (not shown)
admin-c: -
tech-c: -
billing-c: -
created: 2019-08-29
modified: 2020-08-28
expires: 2021-08-29
transferred: 2019-08-29
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: 1 Api GmbH Free SEO Report

Website Inpage Analysis for

H1 Headings

2 :
  2. Få hjälp med flytten

H2 Headings

6 :
  1. Olika typer av städhjälp som du kan få
  2. Städtjänsten för dig
  3. Anledningar att ta hjälp av en städfirma
  4. Vill du kolla upp ditt värmesystem? 
  5. Varför är det så tråkigt att städa? 
  6. Har fasaden blivit tråkig? 

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :


0 :

Total Images

0 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

  1. Startsidan

Links - Internal (nofollow)


Links - Outbound

  1. hemstädning stockholm
  4. fasadtvätt lund

Links - Outbound (nofollow)


Keyword Cloud for

vad dudu villatt dufatt dittattsom sstdfirma somsominteknnerditt huskan dukanbliratt dets attompstdfirmadu intekanskefinnsefterheltdettaavmerhjlp medfasadstdp attnrdu knner attskase tillatt anlitaatt stdastd avvaravillfasadenditt hemseduvenkommertiddu kanse till attrbra attflyttstdningdu knnertill attnyagjordtillblifrdta hjlpatt se tillta hjlp avmandittistllethem rmeds att dusom s attdet smngadenr detknner att duettochdu skaatt grabehverstdhjlpfixafr attnyttgenomanlitahemmetvadflyttlassetsedinellerknner attjustav attstdningenatt sedigtauppdetgolvvrmehardennahemnr duviktigthusallthemmahjlphjlp avblir gjordrentbragrasngonstdasom dugenom atthemstdning

Longtail Keyword Density for

se till att6
s att du4
som s att3
att se till3
du knner att3
knner att du3
ta hjlp av3
att du15
till att10
fr att9
s att8
kan du7
du kan6
hjlp med6
se till6
r det5
hjlp av5
ditt hem5
att det4
nr du4
du knner4
att se3
knner att3
som du3
ta hjlp3
vad du3
att stda3
std av3
det s3
bra att3
ditt hus3
du vill3
blir gjord3
stdfirma som3
att anlita3
genom att3
du inte3
p att3
som s3
du ska3
hem r3
att ditt3
av att3
att gra3
fixa3 Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?

Websites with Similar Names
Welcome to
Home - Fred Ranch
The Worlds Of Fred Rayworth | Author Fred Rayworth's Web Site
Recipes — Fred Recipes
Picture Framing | Custom Frames Buckhead Interior Designers Atlanta

Recently Updated Websites 2 seconds 3 seconds 3 seconds 3 seconds 3 seconds 4 seconds 4 seconds 4 seconds 5 seconds 5 seconds 5 seconds 6 seconds 6 seconds 6 seconds 6 seconds 6 seconds 7 seconds 7 seconds 8 seconds 8 seconds 8 seconds 8 seconds 8 seconds 9 seconds 9 seconds 9 seconds 9 seconds 9 seconds 9 seconds 9 seconds ago.