Freeads.co.uk Website Analysis Summary

Freeads.co.uk  |  Freeads.co.uk : Find Free Classified Ads in the UK at the UK's largest independent free classifieds site. Buy and Sell Puppies, Kittens and other Pets, Horses, Cars, Vans, Household Items, Audio Visual Items and much more in the UK with Freeads Classifieds.
Low trust score  | 
Freeads.co.uk - Classified ads , place Free Ads


Rank
23,313
Rating
F
Trust Score
Low Trust Score
Estimated worth
$652,320
Estimated daily income
$906
Estimated monthly income
$27,558
Backlinks
0

Freeads.co.uk has a Low Trust Score, and a Statvoo Rank of F.

Freeads.co.uk is hosted by Amazon.com, Inc. in Dublin City, Dublin, Ireland, D8.
Freeads.co.uk has an IP Address of 54.77.33.189 and a hostname of ec2-54-77-33-189.eu-west-1.compute.amazonaws..

The domain freeads.co.uk was registered 2 decades 3 years 6 months ago by , it was last modified 5 years 2 months 2 weeks ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 23,313 most popular site among over 300 million websites.

Freeads.co.uk has a total of 0 backlinks.

Freeads.co.uk gets approximately 75,494 unique visitors a day and 452,964 pageviews per day.

Freeads.co.uk has an estimated worth of $652,320.
An average daily income of approximately $906, which is wroughly $27,558 per month.

Whois information for freeads.co.uk

Full Whois Lookup for Freeads.co.uk Whois Lookup

Domain name:
freeads.co.uk

Registrant:
Freeads Classifieds Ltd

Registrant type:
UK Limited Company, (Company number: 4438153)

Registrant's address:
15 Bolton ST
15 Bolton ST
London
London
W1J 8AR
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
netthe.net Limited [Tag = NETTHENET]
URL: http://www.netthe.net

Relevant dates:
Registered on: before Aug-1996
Expiry date: 13-Jan-2018
Last updated: 22-Dec-2016

Registration status:
Registered until expiry date.

Name servers:
ns-1383.awsdns-44.org
ns-1933.awsdns-49.co.uk 205.251.199.141
ns-31.awsdns-03.com
ns-688.awsdns-22.net

WHOIS lookup made at 07:21:15 31-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Freeads.co.uk?

Freeads.co.uk Web Server Information

Hosted IP Address:54.77.33.189
Hosted Hostname:ec2-54-77-33-189.eu-west-1.compute.amazonaws.
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:Not Applicable

HTTP Header Analysis for Freeads.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 14 Jun 2015 18:10:02 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 25724
Connection: close
X-Powered-By: PHP/5.3.29
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Last-Modified: Sun, 14 Jun 2015 18:19:41 GMT
Cache-Control: post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
X-UA-Compatible: IE=Edge,chrome=1

Need to find out who hosts Freeads.co.uk?

Freeads.co.uk Free SEO Report

Website Inpage Analysis for Freeads.co.uk

H1 Headings:1
Welcome to freeadsFind 80,127 classified ads near you online today!
H2 Headings:43
Post a free ad in under 60 seconds
Find & buy exactly what you want
Based on 49,623 customer ratings
Select a location
Recently Viewed Ads
Watched Ads
See our lovely rescues
Ads from powered by
Latest FREE Stuff
Pets
Equestrian
Sound & Vision
Motors
Leisure & Hobbies
Free stuff
Dating
Services
Computers & Gaming
Home & Garden
Jobs
Property
Community
Business
Dating
Recently Viewed Ads
Watched Ads
See our lovely rescues
Ads from  powered by
Latest FREE Stuff
Customer Reviews
For sale
Dogs for sale
Horses for sale
Motors
Cats for sale
Other pets
For sale
Dogs for sale
Horses for sale
Motors
Cats for sale
Other pets
Tell us where you areto get local ads
H3 Headings:6
Most popular
Social
Customer Reviews
Supported Charities
We love pets!
Most popular
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:161
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Freeads.co.uk

googletagdefineslot306025875webherobannerhomepageresponsiveatf 728 90googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 300 250rnpositionshalfpagewindows600 divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction250 divgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205644rnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250googletagsizemappingaddsize320320 50rn buildrngoogletagdisplaydivgptad137416031205643 rnrnrnhalfpagernrngoogletagcmdpushfunctiongoogletagdisplaydivgptad137416031205647 rnrnrnlargebuttonhomepageherobannerrnrngoogletagenableservicesrn90 divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205643200 970 90buildrnpositionslbbottom600 divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction90rn addsize320googletagcmd googletagcmd rnrnrn200 970var googletag googletagrnpositionsmpurnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14980610474500 rnrnlbbottomrngoogletagcmdpushfunction50rnmappingrnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 300googletagsizemappingaddsize320 200function0 970googletag rnmapping googletagsizemappingaddsize320 200320 50addsize768 200divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunctiongoogletagdisplaydivgptad137416031205647googletagdisplaydivgptad137416031205644600 divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctionaddsize1360 0rnrnlbbottomrngoogletagcmdpushfunction rn var90addsize1340 200 970googletag googletaggoogletagdisplaydivgptad137416031205643 rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpagegoogletagsizemappingrn addsize1360250 divgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4250rn0 970 250rn6googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250rnrnrnlargebuttonhomepageherobannerrnrn728 90addsize1340 20090 divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctiondivgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205644 rnrnrnsuperskyrngoogletagcmdpushfunctionmapping googletagsizemappingrn addsize136090buildrnpositionslbbottomgoogletagsizemappingaddsize320 200 320googletagdisplaydivgptad14980610474500 rnrnlbbottomrngoogletagcmdpushfunction rn90rnbuildrn positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf970 250rn addsize99290buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90addsize992600 divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14019794574650rnrnlbbottomrngoogletagcmdpushfunction rngoogletagcmdpushfunction rn varrnpositionssuperskyleft160 60030googletag googletag rnaddsize320googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 30090rn addsize320 0250rn addsize992 0divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrndivgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctiongoogletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160 600300 250 divgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctiongoogletagdisplaydivgptad137416031205644 rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky728 90googletagdisplaydivgptad14980610474500 rnrnlbbottomrngoogletagcmdpushfunctiondivgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctionrnrnrn googletagcmdpushfunction290rn addsize768728 90rn90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728googletagdisplaydivgptad14019794574650buildrngoogletagvar50addsize768 200 728300 600 divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunctionrnrnrnlargebuttonhomepageherobannerrnrn varrnpositionssuperskyleft googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160300 250divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrnrn var250rn addsize992googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160googletagdisplaydivgptad137416031205648 rnrnrnsuperskyleftrngoogletagcmdpushfunction rnpositionssuperskyleft9970 250rn728 90 divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctionrnrnrnlargebuttonhomepageherobannerrnrn var googletagdivgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205647googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 30050addsize768 200rnrnrnsuperskyleftrngoogletagcmdpushfunction50rn buildrngoogletagpubadscollapseemptydivsrn googletagenableservicesrnbuildrn positionsherobannergoogletagcmd rnrnrn320 50addsize7687mapping googletagsizemappingaddsize320googletagdisplaydivgptad137416031205644 rnrnrnsuperskyrngoogletagcmdpushfunction0 728googletagdisplaydivgptad1498061047450090 divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrngoogletagpubadscollapseemptydivsrn90addsize1340 200addsize992 0divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205647 rnrnrnlargebuttonhomepageherobannerrnrnaddsize1360 0 970divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad1401979457465090 divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrndivgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205643 rnrnrnhalfpagernrngoogletagcmdpushfunctiongoogletagdefineslot306025875webherobannerhomepageresponsiveatfrnrnrnsuperskyrngoogletagcmdpushfunctionrnrnlbbottomrngoogletagcmdpushfunction200 320 50addsize768970 90buildrnpositionslbbottomrnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600160 600 divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction600 divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205648divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn googletagenableservicesrnrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14980610474500googletagdisplaydivgptad137416031205648 rnrnrnsuperskyleftrngoogletagcmdpushfunctionaddsize992 0 728addsize320 0googletagcmdpushfunction rn300 600var mappingvar mapping googletagsizemappingrngoogletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunctiongoogletagsizemappingrn addsize1360 0positionsherobanner200 320addsize1360rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage50addsize768googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728 90200 728 90addsize1340rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 300var mapping googletagsizemappingaddsize320rn90rn addsize768 0googletagcmdrn googletagcmdgoogletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 300 6000 320var googletaggoogletagdisplaydivgptad137416031205648positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatfaddsize768 0 728728 90addsize1340728 90rn addsize320googletagdisplaydivgptad137416031205647 rnrnrnlargebuttonhomepageherobannerrnrn vardivgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205644rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky90addsize1340googletagsizemappingrndivgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad1374160312056480 320 50rn320 50rnrnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600googletagcmdpushfunctiondivgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction728 90rn addsize768mapping googletagsizemappingrngoogletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14980610474500googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205643rnrnrnsuperskyleftrngoogletagcmdpushfunction rnpositionssuperskyleft googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600addsize7685rnrnrnhalfpagernrngoogletagcmdpushfunctiongoogletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728googletagdisplaydivgptad137416031205643divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctiongoogletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90googletag rn googletagcmdrnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205648 rnrnrnsuperskyleftrngoogletagcmdpushfunction970 90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90rnrnrnsuperskyleftrngoogletagcmdpushfunction rnpositionssuperskyleft0 728 90rnrnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600addsize768 0600 divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205647200 728googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600rn var mappinggoogletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160 60050rn buildrn positionsherobannerrnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600rnrnrn googletagcmdpushfunction rnrnrnrngoogletagcmd googletagcmd160 600 divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctionpositionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf 72818rnpositionssuperskyrnrnrnrnrnrngoogletagcmdpushfunctionrn googletagcmd googletagcmdrnpositionssuperskyleft googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600728 90 divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrngoogletagcmd rnrnrn googletagcmdpushfunctionaddsize320 0 320googletagdefineslot306025875webherobannerhomepageresponsiveatf 728googletagpubadscollapseemptydivsrn googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction

Longtail Keyword Density for Freeads.co.uk

KeywordsOccurences
0 728 90rn8
rn var mapping8
googletag rn googletagcmd6
rn googletagcmd googletagcmd6
googletag googletag rn6
var googletag googletag6
googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1498061047450-05
googletagpubadscollapseemptydivsrn googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction5
div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn googletagenableservicesrn4
rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1498061047450-0 rnrnlbbottomrngoogletagcmdpushfunction4
300 600 div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction4
var mapping googletagsizemappingaddsize3204
rnrnlbbottomrngoogletagcmdpushfunction rn var4
googletagdisplaydiv-gpt-ad-1498061047450-0 rnrnlbbottomrngoogletagcmdpushfunction rn4
90 div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn4
728 90 div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn4
50rn buildrn positionsherobanner4
320 50rn buildrn4
0 320 50rn4
buildrn positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf4
600 div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1401979457465-04
googletagdefineslot306025875webherobannerhomepageresponsiveatf 728 904
positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf 7284
mapping googletagsizemappingaddsize320 2004
googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 300 6004
970 90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x904
200 970 90buildrnpositionslbbottom4
90addsize1340 200 9704
90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 7284
googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728 904
div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-43 rnrnrnhalfpagernrngoogletagcmdpushfunction4
90 div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-434
728 90 div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
728 90addsize1340 2004
200 728 90addsize13404
addsize320 0 3204
rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x6004
rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 3004
googletagsizemappingaddsize320 200 3204
200 320 50addsize7684
50addsize768 200 7284
320 50addsize768 2004
googletagdisplaydiv-gpt-ad-1374160312056-43 rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage4
90rn addsize768 04
googletagdisplaydiv-gpt-ad-1374160312056-48 rnrnrnsupersky-leftrngoogletagcmdpushfunction rnpositionssupersky-left4
div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-48 rnrnrnsupersky-leftrngoogletagcmdpushfunction4
600 div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-484
rnrnrnsupersky-leftrngoogletagcmdpushfunction rnpositionssupersky-left googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x6004
rnpositionssupersky-left googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 1604
600 div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-474
160 600 div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160 6004
160 600 div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160 6004
250 div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-444
300 250 div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 300 2504
div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-44 rnrnrnsuperskyrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-44 rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky4
rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 1604
rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x6004
div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-47 rnrnrnlargebuttonhomepageherobannerrnrn4
googletagdisplaydiv-gpt-ad-1374160312056-47 rnrnrnlargebuttonhomepageherobannerrnrn var4
250rn addsize992 04
970 250rn addsize9924
0 970 250rn4
addsize992 0 7284
728 90rn addsize7684
728 90rn addsize3204
addsize768 0 7284
rnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 3004
addsize1360 0 9704
googletagsizemappingrn addsize1360 04
googletagcmd rnrnrn googletagcmdpushfunction4
googletagcmd googletagcmd rnrnrn4
rnrnrnlargebuttonhomepageherobannerrnrn var googletag4
rnrnrn googletagcmdpushfunction rn4
googletagcmdpushfunction rn var4
mapping googletagsizemappingrn addsize13604
var mapping googletagsizemappingrn4
90rn addsize320 04
rn var9
var mapping8
0 7288
728 908
160 6008
728 90rn8
googletagcmd googletagcmd6
var googletag6
googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction6
rn googletagcmd6
googletag rn6
googletag googletag6
googletagcmdpushfunction rn6
rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1498061047450-05
googletagpubadscollapseemptydivsrn googletagenableservicesrn5
300 2505
positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf5
200 3204
320 50addsize7684
googletagdisplaydiv-gpt-ad-1498061047450-0 rnrnlbbottomrngoogletagcmdpushfunction4
90 div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn4
googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 3004
googletagdefineslot306025875webherobannerhomepageresponsiveatf 7284
div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn4
50addsize768 2004
mapping googletagsizemappingaddsize3204
rnrnlbbottomrngoogletagcmdpushfunction rn4
googletagsizemappingaddsize320 2004
90addsize1340 2004
rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x6004
rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage4
googletagdisplaydiv-gpt-ad-1374160312056-43 rnrnrnhalfpagernrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 3004
300 6004
div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1401979457465-04
600 div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction4
div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-434
90 div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
buildrn positionsherobanner4
728 90addsize13404
200 9704
970 90buildrnpositionslbbottom4
googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 7284
90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x904
200 7284
90rn addsize3204
div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-474
600 div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 1604
googletagdisplaydiv-gpt-ad-1374160312056-47 rnrnrnlargebuttonhomepageherobannerrnrn4
rnrnrnlargebuttonhomepageherobannerrnrn var4
rnrnrn googletagcmdpushfunction4
googletagcmd rnrnrn4
rnpositionssupersky-left googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x6004
rnrnrnsupersky-leftrngoogletagcmdpushfunction rnpositionssupersky-left4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 1604
rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x6004
googletagdisplaydiv-gpt-ad-1374160312056-44 rnrnrnsuperskyrngoogletagcmdpushfunction4
600 div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-48 rnrnrnsupersky-leftrngoogletagcmdpushfunction4
div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-484
div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-444
250 div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
addsize768 04
90rn addsize7684
rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky4
addsize320 04
320 50rn4
0 3204
rnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x2504
addsize992 04
googletagsizemappingrn addsize13604
mapping googletagsizemappingrn4
addsize1360 04
0 9704
250rn addsize9924
970 250rn4
50rn buildrn4
var20
020
rn19
116
212
googletag12
googletagcmd12
312
410
59
68
mapping8
78
88
90rn8
googletagenableservicesrn6
googletagcmdpushfunction6
rnrnrnrnrnrngoogletagcmdpushfunction6
googletagdisplaydiv-gpt-ad-1498061047450-05
positionsherobanner5
googletagdefineslot306025875webherobannerhomepageresponsiveatf5
googletagpubadscollapseemptydivsrn5
rnpositionshalfpage5
95
div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn4
googletagsizemappingaddsize3204
googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x6004
rnrnrnhalfpagernrngoogletagcmdpushfunction4
div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1401979457465-04
windows4
googletagdisplaydiv-gpt-ad-1374160312056-434
div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
50addsize7684
buildrn4
90addsize13404
90buildrnpositionslbbottom4
googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x904
rnrnlbbottomrngoogletagcmdpushfunction4
250rn4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x6004
div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-484
rnrnrnsupersky-leftrngoogletagcmdpushfunction4
rnpositionssupersky4
rnrnrnsuperskyrngoogletagcmdpushfunction4
rnpositionsmpu4
googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x2504
div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-444
rnpositionssupersky-left4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x6004
addsize13604
addsize9924
addsize7684
addsize3204
50rn4
googletagsizemappingrn4
div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-474
rnrnrnlargebuttonhomepageherobannerrnrn4
rnrnrn4
function3

What are the nameservers for freeads.co.uk?

Freeads.co.uk Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown