Freeads.co.uk  |  Freeads.co.uk - Classified ads , place Free Ads
Low trust score  | 
Freeads.co.uk : Find Free Classified Ads in the UK at the UK's largest independent free classifieds site. Buy and Sell Puppies, Kittens and other Pets, Horses, Cars, Vans, Household Items, Audio Visual Items and much more in the UK with Freeads Classifieds.

Freeads.co.uk Website Information

Freeads.co.uk has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 50,754, a Majestic Rank of 188,057, a Domain Authority of 39% and is not listed in DMOZ.

Freeads.co.uk is hosted by Amazon.com, Inc. in Dublin City, Dublin, Ireland, D8.
Freeads.co.uk has an IP Address of 54.77.33.189 and a hostname of ec2-54-77-33-189.eu-west-1.compute.amazonaws..

The domain freeads.co.uk was registered 2 decades 2 years 11 months ago by , it was last modified 4 years 7 months 2 weeks ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for freeads.co.uk

Full Whois Lookup for Freeads.co.uk Whois Lookup

Domain name:
freeads.co.uk

Registrant:
Freeads Classifieds Ltd

Registrant type:
UK Limited Company, (Company number: 4438153)

Registrant's address:
15 Bolton ST
15 Bolton ST
London
London
W1J 8AR
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
netthe.net Limited [Tag = NETTHENET]
URL: http://www.netthe.net

Relevant dates:
Registered on: before Aug-1996
Expiry date: 13-Jan-2018
Last updated: 22-Dec-2016

Registration status:
Registered until expiry date.

Name servers:
ns-1383.awsdns-44.org
ns-1933.awsdns-49.co.uk 205.251.199.141
ns-31.awsdns-03.com
ns-688.awsdns-22.net

WHOIS lookup made at 07:21:15 31-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Freeads.co.uk?

Freeads.co.uk Web Server Information

Hosted IP Address:54.77.33.189
Hosted Hostname:ec2-54-77-33-189.eu-west-1.compute.amazonaws.
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:Not Applicable

HTTP Header Analysis for Freeads.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 14 Jun 2015 18:10:02 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 25724
Connection: close
X-Powered-By: PHP/5.3.29
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Last-Modified: Sun, 14 Jun 2015 18:19:41 GMT
Cache-Control: post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
X-UA-Compatible: IE=Edge,chrome=1


Need to find out who hosts Freeads.co.uk?

Freeads.co.uk Free SEO Report

Website Inpage Analysis for Freeads.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Freeads.co.uk

728 90rn addsize3203addsize992300 250googletagcmdpushfunction rnrnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600300 600positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf 728function50addsize768 200 728divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205643googletagpubadscollapseemptydivsrndivgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction90rn addsize320 0728 90googletagsizemappingrnrnrnlbbottomrngoogletagcmdpushfunction rn200 970rn googletagcmddivgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn90rn addsize768970 250rn addsize992rnrnrnrnrnrngoogletagcmdpushfunctiondivgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctiongoogletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14980610474500var mapping googletagsizemappingrngoogletagsizemappingaddsize320addsize1360 00 970 250rngoogletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunctiongoogletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 300rn varrn googletagcmd googletagcmdrnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600728 90rnbuildrn positionsherobannerrnrnlbbottomrngoogletagcmdpushfunctiongoogletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90googletagdefineslot306025875webherobannerhomepageresponsiveatf90 divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn90rn addsize768 0mapping googletagsizemappingaddsize320 200googletagsizemappingrn addsize1360googletagdisplaydivgptad137416031205644 rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky970 90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x9090 divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction320 50addsize768mapping googletagsizemappingrn addsize1360rnrnrn90rngoogletagcmdpushfunction rn varpositionsherobanner0728 90addsize1340 200rnrnrn googletagcmdpushfunctionrnpositionssuperskyrnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 300googletagdisplaydivgptad13741603120564390addsize1340 200 970rnpositionssuperskyleft googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctiongoogletagcmd rnrnrn googletagcmdpushfunctiondivgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205643 rnrnrnhalfpagernrngoogletagcmdpushfunctionaddsize992 0 728160 600 divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4var mappinggoogletagdisplaydivgptad137416031205643 rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpagevar googletag googletagrnrnrnlargebuttonhomepageherobannerrnrn vargoogletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 300 250googletagdisplaydivgptad137416031205647 rnrnrnlargebuttonhomepageherobannerrnrn var9mapping googletagsizemappingrn728 90addsize1340varaddsize768 0googletagcmd600 divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad140197945746500 72850addsize768 20090buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x9090rn addsize320googletagdefineslot306025875webherobannerhomepageresponsiveatf 728 90buildrnrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14980610474500 rnrnlbbottomrngoogletagcmdpushfunction200 320divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205648 rnrnrnsuperskyleftrngoogletagcmdpushfunctiongoogletagcmd rnrnrndivgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205648600 divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205648728 90 divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction50rn buildrn positionsherobannerrnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssuperskygoogletag rngoogletagdisplaydivgptad137416031205647rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205647 rnrnrnlargebuttonhomepageherobannerrnrnrnrnrnsuperskyrngoogletagcmdpushfunctiondivgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction8600 divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205647200 970 90buildrnpositionslbbottomaddsize320 0 320googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160 600rnrnrnsuperskyleftrngoogletagcmdpushfunction250rnrnrnrnsuperskyleftrngoogletagcmdpushfunction rnpositionssuperskyleft googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600googletagdisplaydivgptad137416031205647 rnrnrnlargebuttonhomepageherobannerrnrnrnrnrnsuperskyleftrngoogletagcmdpushfunction rnpositionssuperskyleftgoogletagdisplaydivgptad149806104745001var googletaggoogletagpubadscollapseemptydivsrn googletagenableservicesrngoogletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728 90googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600googletagdisplaydivgptad137416031205643 rnrnrnhalfpagernrngoogletagcmdpushfunctiongoogletagdisplaydivgptad1401979457465090addsize1340200 7280 320 50rn0 320googletagcmdpushfunction200 320 50addsize768rnrnrnhalfpagernrngoogletagcmdpushfunctiongoogletagdisplaydivgptad14980610474500 rnrnlbbottomrngoogletagcmdpushfunctiongoogletaggoogletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160rnpositionssuperskyleftvar mapping googletagsizemappingaddsize320rnpositionshalfpage0 728 90rngoogletagsizemappingaddsize320 200mapping googletagsizemappingaddsize320970 250rnrnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600250rn addsize992 0googletagdisplaydivgptad14980610474500 rnrnlbbottomrngoogletagcmdpushfunction rngoogletag googletag rn300 600 divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction50rngoogletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160rn var mappingrnpositionsmpu50addsize768320 50addsize768 200windowsdivgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205644600 divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctiongoogletagdisplaydivgptad137416031205648googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x60090 divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrnrnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpageaddsize76890buildrnpositionslbbottomgoogletagpubadscollapseemptydivsrn googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction50rn buildrnaddsize768 0 728rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600160 600addsize320200 728 90addsize1340googletagdisplaydivgptad137416031205648 rnrnrnsuperskyleftrngoogletagcmdpushfunction rnpositionssuperskyleft5googletagsizemappingaddsize320 200 320728 90 divgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrn90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728600 divgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction320 50rndivgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrndivgptad14980610474500definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn googletagenableservicesrnrnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x25090addsize1340 20090 divgptad137416031205643definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205643googletagdisplaydivgptad137416031205648 rnrnrnsuperskyleftrngoogletagcmdpushfunctiondivgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205647rnpositionssuperskyleft googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600mappingrnrnrnlargebuttonhomepageherobannerrnrnrnrnlbbottomrngoogletagcmdpushfunction rn var7addsize992 0googletagsizemappingrn addsize1360 0addsize320 0googletagdisplaydivgptad137416031205644googletagdefineslot306025875webherobannerhomepageresponsiveatf 7282googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160 600googletagenableservicesrngoogletagcmd googletagcmd rnrnrn320 50rn buildrndivgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205644 rnrnrnsuperskyrngoogletagcmdpushfunctiongoogletag googletag250rn addsize992googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 300 600970 90buildrnpositionslbbottomdivgptad14019794574650addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14019794574650googletagdisplaydivgptad137416031205644 rnrnrnsuperskyrngoogletagcmdpushfunctiondivgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction0 970addsize1360250 divgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction600 divgptad137416031205647addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction250 divgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad137416031205644rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydivgptad14980610474500300 250 divgptad137416031205644addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction6buildrn positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf160 600 divgptad137416031205648addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunctionpositionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatfgoogletagcmd googletagcmdgoogletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600rnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 300728 90rn addsize768rngoogletag rn googletagcmdrnrnrn googletagcmdpushfunction rngoogletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 300rnrnrnlargebuttonhomepageherobannerrnrn var googletagaddsize1360 0 970

Longtail Keyword Density for Freeads.co.uk

KeywordsOccurences
0 728 90rn8
rn var mapping8
googletag rn googletagcmd6
rn googletagcmd googletagcmd6
googletag googletag rn6
var googletag googletag6
googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1498061047450-05
googletagpubadscollapseemptydivsrn googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction5
div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn googletagenableservicesrn4
rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1498061047450-0 rnrnlbbottomrngoogletagcmdpushfunction4
300 600 div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction4
var mapping googletagsizemappingaddsize3204
rnrnlbbottomrngoogletagcmdpushfunction rn var4
googletagdisplaydiv-gpt-ad-1498061047450-0 rnrnlbbottomrngoogletagcmdpushfunction rn4
90 div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn4
728 90 div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn4
50rn buildrn positionsherobanner4
320 50rn buildrn4
0 320 50rn4
buildrn positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf4
600 div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1401979457465-04
googletagdefineslot306025875webherobannerhomepageresponsiveatf 728 904
positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf 7284
mapping googletagsizemappingaddsize320 2004
googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 300 6004
970 90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x904
200 970 90buildrnpositionslbbottom4
90addsize1340 200 9704
90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 7284
googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 728 904
div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-43 rnrnrnhalfpagernrngoogletagcmdpushfunction4
90 div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-434
728 90 div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
728 90addsize1340 2004
200 728 90addsize13404
addsize320 0 3204
rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x6004
rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 3004
googletagsizemappingaddsize320 200 3204
200 320 50addsize7684
50addsize768 200 7284
320 50addsize768 2004
googletagdisplaydiv-gpt-ad-1374160312056-43 rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage4
90rn addsize768 04
googletagdisplaydiv-gpt-ad-1374160312056-48 rnrnrnsupersky-leftrngoogletagcmdpushfunction rnpositionssupersky-left4
div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-48 rnrnrnsupersky-leftrngoogletagcmdpushfunction4
600 div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-484
rnrnrnsupersky-leftrngoogletagcmdpushfunction rnpositionssupersky-left googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x6004
rnpositionssupersky-left googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 1604
600 div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-474
160 600 div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 160 6004
160 600 div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 160 6004
250 div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-444
300 250 div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 300 2504
div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-44 rnrnrnsuperskyrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-44 rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky4
rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 1604
rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x6004
div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-47 rnrnrnlargebuttonhomepageherobannerrnrn4
googletagdisplaydiv-gpt-ad-1374160312056-47 rnrnrnlargebuttonhomepageherobannerrnrn var4
250rn addsize992 04
970 250rn addsize9924
0 970 250rn4
addsize992 0 7284
728 90rn addsize7684
728 90rn addsize3204
addsize768 0 7284
rnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 3004
addsize1360 0 9704
googletagsizemappingrn addsize1360 04
googletagcmd rnrnrn googletagcmdpushfunction4
googletagcmd googletagcmd rnrnrn4
rnrnrnlargebuttonhomepageherobannerrnrn var googletag4
rnrnrn googletagcmdpushfunction rn4
googletagcmdpushfunction rn var4
mapping googletagsizemappingrn addsize13604
var mapping googletagsizemappingrn4
90rn addsize320 04
rn var9
var mapping8
0 7288
728 908
160 6008
728 90rn8
googletagcmd googletagcmd6
var googletag6
googletagenableservicesrn rnrnrnrnrnrngoogletagcmdpushfunction6
rn googletagcmd6
googletag rn6
googletag googletag6
googletagcmdpushfunction rn6
rnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1498061047450-05
googletagpubadscollapseemptydivsrn googletagenableservicesrn5
300 2505
positionsherobanner googletagdefineslot306025875webherobannerhomepageresponsiveatf5
200 3204
320 50addsize7684
googletagdisplaydiv-gpt-ad-1498061047450-0 rnrnlbbottomrngoogletagcmdpushfunction4
90 div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn4
googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x250 3004
googletagdefineslot306025875webherobannerhomepageresponsiveatf 7284
div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn googletagpubadscollapseemptydivsrn4
50addsize768 2004
mapping googletagsizemappingaddsize3204
rnrnlbbottomrngoogletagcmdpushfunction rn4
googletagsizemappingaddsize320 2004
90addsize1340 2004
rnpositionshalfpage googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x6004
rnrnrnhalfpagernrngoogletagcmdpushfunction rnpositionshalfpage4
googletagdisplaydiv-gpt-ad-1374160312056-43 rnrnrnhalfpagernrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x600 3004
300 6004
div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1401979457465-04
600 div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction4
div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-434
90 div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
buildrn positionsherobanner4
728 90addsize13404
200 9704
970 90buildrnpositionslbbottom4
googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x90 7284
90buildrnpositionslbbottom googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x904
200 7284
90rn addsize3204
div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-474
600 div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x600 1604
googletagdisplaydiv-gpt-ad-1374160312056-47 rnrnrnlargebuttonhomepageherobannerrnrn4
rnrnrnlargebuttonhomepageherobannerrnrn var4
rnrnrn googletagcmdpushfunction4
googletagcmd rnrnrn4
rnpositionssupersky-left googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x6004
rnrnrnsupersky-leftrngoogletagcmdpushfunction rnpositionssupersky-left4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x600 1604
rnpositionssupersky googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x6004
googletagdisplaydiv-gpt-ad-1374160312056-44 rnrnrnsuperskyrngoogletagcmdpushfunction4
600 div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-48 rnrnrnsupersky-leftrngoogletagcmdpushfunction4
div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-484
div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction googletagdisplaydiv-gpt-ad-1374160312056-444
250 div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
addsize768 04
90rn addsize7684
rnrnrnsuperskyrngoogletagcmdpushfunction rnpositionssupersky4
addsize320 04
320 50rn4
0 3204
rnpositionsmpu googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x2504
addsize992 04
googletagsizemappingrn addsize13604
mapping googletagsizemappingrn4
addsize1360 04
0 9704
250rn addsize9924
970 250rn4
50rn buildrn4
var20
020
rn19
116
212
googletag12
googletagcmd12
312
410
59
68
mapping8
78
88
90rn8
googletagenableservicesrn6
googletagcmdpushfunction6
rnrnrnrnrnrngoogletagcmdpushfunction6
googletagdisplaydiv-gpt-ad-1498061047450-05
positionsherobanner5
googletagdefineslot306025875webherobannerhomepageresponsiveatf5
googletagpubadscollapseemptydivsrn5
rnpositionshalfpage5
95
div-gpt-ad-1498061047450-0definesizemappingmappingaddservicegoogletagpubadsrn4
googletagsizemappingaddsize3204
googletagdefineslot306025875webhomepageandmyfreeadshalfpageatf300x6004
rnrnrnhalfpagernrngoogletagcmdpushfunction4
div-gpt-ad-1401979457465-0addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1401979457465-04
windows4
googletagdisplaydiv-gpt-ad-1374160312056-434
div-gpt-ad-1374160312056-43definesizemappingmappingaddservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
50addsize7684
buildrn4
90addsize13404
90buildrnpositionslbbottom4
googletagdefineslot306025875webhomepageandmyfreeadsleaderboardbtf728x904
rnrnlbbottomrngoogletagcmdpushfunction4
250rn4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperbtf160x6004
div-gpt-ad-1374160312056-48addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-484
rnrnrnsupersky-leftrngoogletagcmdpushfunction4
rnpositionssupersky4
rnrnrnsuperskyrngoogletagcmdpushfunction4
rnpositionsmpu4
googletagdefineslot306025875webhomepageandmyfreeadsmpuatf300x2504
div-gpt-ad-1374160312056-44addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-444
rnpositionssupersky-left4
googletagdefineslot306025875webhomepageandmyfreeadswideskyscraperatf160x6004
addsize13604
addsize9924
addsize7684
addsize3204
50rn4
googletagsizemappingrn4
div-gpt-ad-1374160312056-47addservicegoogletagpubadsrngoogletagenableservicesrnrnrnrnrnrngoogletagcmdpushfunction4
googletagdisplaydiv-gpt-ad-1374160312056-474
rnrnrnlargebuttonhomepageherobannerrnrn4
rnrnrn4
function3

What are the nameservers for freeads.co.uk?

Freeads.co.uk Domain Nameserver Information

HostIP AddressCountry
ns-1383.awsdns-44.org 205.251.197.103United States United States
ns-1933.awsdns-49.co.uk 205.251.199.141United States United States
ns-31.awsdns-03.com 205.251.192.31United States United States
ns-688.awsdns-22.net 205.251.194.176United States United States

Freeads.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Freeads.co.uk is a scam?