|  Free Advice - Free Legal Advice and Answers to Law Questions from Lawyers, and Insurance Advice, Ratings and Quotes.
Low trust score  | 
Free Advice is the best law site for consumers, with free answers to legal questions from lawyers, attorneys and experts. Free advice about insurance, with auto, homeowners, life, and health insurance policy quotes and company reviews. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:43,527
Majestic Rank Majestic Rank:30,568
Domain Authority Domain Authority:60%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: 007NAMES, INC.
Registration Date:1996-03-27  2 decades 3 years 3 weeks ago
Last Modified:2011-06-21  7 years 10 months 2 days ago
Expiration Date:2020-02-16  9 months 2 weeks 2 days from now

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: 1281445_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2011-06-21T17:45:27Z
Creation Date: 1996-03-27T05:00:00Z
Registry Expiry Date: 2020-02-16T04:59:59Z
Registrar: 007Names, Inc.
Registrar IANA ID: 91
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 908-722-2211
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-23T22:26:17Z

Who hosts is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4889
Location Longitude:-98.3987
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 17 Jun 2015 10:38:22 GMT
Server: Apache
Expires: Wed, 24 Jun 2015 10:38:22 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-3387887484387515
Google Analytics:Not Applicable

Keyword Cloud for

foundcar accidentfreeadvicelawyeranswered todayaskyourifmycontributing attorneycare advicenotdokeep readinganswered by freeadvicecanquestionattorneyitscarelegalaccidentrecentansweredlawgetcardrunkinsurancetoday answeredfreeadvice contributing attorneytodaypersoncompanydatadrivinghellipanswerscustodyhavefaultanswered today answeredreading0freeadvice contributingadvicearticlehelpfindyoumoreuscontributinghellip keep readingsenior carekeepseniorfreehellip keeparticle foundsenior care adviceclaim

Longtail Keyword Density for

hellip keep reading6
freeadvice contributing attorney5
answered by freeadvice5
answered today answered5
senior care advice3
keep reading6
hellip keep6
today answered5
freeadvice contributing5
contributing attorney5
answered today5
article found4
car accident4
senior care4
care advice3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?