FreeBitco.in - Bitcoin, Bitcoin Price, Free Bitcoin Wallet, Faucet, Lottery and Dice!

Safety: High trust score
Year Founded: 2013
Global Traffic Rank: 3,103
Estimated Worth: $5,206,680
Category: Gambling > Lottery

Win upto $200 in Bitcoins every hour, no strings attached! Multiply your bitcoins, free weekly lottery with big prizes, 50% referral commissions and much more!



Domain summary

Last updated
2021-06-14
Domain label
freebitco
Domain extension
in
Domain registered:
2013-10-10
Domain updated:
2021-06-14
Global Traffic Rank
3,103
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$5,206,680
Estimated daily income
$4,821
Estimated monthly income
$146,639

Frequently Asked Questions (FAQ)

Q: When was Freebitco.in registered?
A: Freebitco.in was registered 7 years, 8 months, 1 week, 4 days, 12 hours, 44 minutes, 26 seconds ago on Thursday, October 10, 2013.
Q: When was the WHOIS for Freebitco.in last updated?
A: The WHOIS entry was last updated 1 week, 12 hours, 44 minutes, 26 seconds ago on Monday, June 14, 2021.
Q: What are Freebitco.in's nameservers?
A: DNS for Freebitco.in is provided by the following nameservers:
  • tom.ns.cloudflare.com
  • dina.ns.cloudflare.com
Q: Who is the registrar for the Freebitco.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Freebitco.in?
A: Freebitco.in ranks 3,103 globally on Alexa. Freebitco.in has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Freebitco.in each day?
A: Freebitco.in receives approximately 602,643 visitors and 4,821,144 page impressions per day.
Q: What IP address does Freebitco.in resolve to?
A: Freebitco.in resolves to the IPv4 address .
Q: In what country are Freebitco.in servers located in?
A: Freebitco.in has servers located in the .
Q: What webserver software does Freebitco.in use?
A: Freebitco.in is powered by CloudFlare webserver.
Q: Who hosts Freebitco.in?
A: Freebitco.in is hosted by Unknown in .
Q: How much is Freebitco.in worth?
A: Freebitco.in has an estimated worth of $5,206,680. An average daily income of approximately $4,821, which is roughly $146,639 per month.

Freebitco.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Freebitco.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Freebitco.in

H1 Headings

1 :
  1. freebitcoin

H2 Headings

0 :

H3 Headings

7 :
  1. WIN FREE BITCOINS EVERY HOUR!
  2. FEATURES
  3. WHAT IS BITCOIN?
  4. FORGOT YOUR PASSWORD?
  5. RESET YOUR 2 FACTOR AUTHENTICATION
  6. TERMS OF SERVICE
  7. PRIVACY POLICY

H4 Headings

0 :

H5 Headings

11 :
  1. CREATE AN ACCOUNT
  2. LOGIN TO YOUR ACCOUNT
  3. FREE BITCOINS EVERY HOUR
  4. PROVABLY FAIR HI-LO GAME
  5. REFERRAL CONTEST
  6. WAGERING CONTEST
  7. EARN INTEREST ON YOUR DEPOSITS
  8. PEER-TO-PEER (P2P) EVENT PREDICTION TO MULTIPLY BTC
  9. FREE WEEKLY LOTTERY
  10. GENEROUS REFERRAL PROGRAM
  11. WIN A LAMBORGHINI

H6 Headings

7 :
  1.  WIN UP TO $200 IN FREE BITCOINS
  2.  MULTIPLY YOUR BITCOINS PLAYING HI-LO
  3.  WIN HI-LO JACKPOTS UP TO 1 BITCOIN
  4.  FREE WEEKLY LOTTERY WITH BIG PRIZES
  5.  WIN A LAMBORGHINI WITH GOLDEN TICKETS
  6.  BITCOIN SAVINGS ACCOUNT WITH DAILY INTEREST
  7.  50% REFERRAL COMMISSIONS FOR LIFE

Total IFRAMEs

0 :

Total Images

14 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for Freebitco.in

experiencebitcoinsimportant paddinglefthouryouprovideserviceprovablyreferralupfactorplay now playnbspwin200 in freefreeyour favorite eventsloginimportant textdecoration4betsendevery hourif youdicebitcoins every hourhiloimportantuseusingallfff importantyour favoritetimeyour accounthavecontestpolicyprizessimplefavorite eventsdoiftrymayimproveenterpassword resetplayingweeklypaddingleftnorepeatwinaddress passwordresetinterestnobtcbitcoincolor fff importantbigfree bitcoins every0do notweekly lotteryemailup to 200now play nowplay nowyour computercreateplease enterusesgetweany3documentreadyfunctionfree bitcoinsplaylotterylamborghinimultiplypassword2information2 factorcolor fffwebsitenotcreate an accountauthenticationyourfreebitcoinourusedaddressnorepeat 0we mayour websiteeventscookiesplease12 factor authenticationfactor authenticationbackgroundtextdecorationsend youcomputeraccountnow2faoverticketscolorwebsite weeveryevery timebelowusgameprovably fair1 bitcoinwageringusersbitcoins everygoldenemail addressnow playffffairfavorite

Longtail Keyword Density for Freebitco.in

KeywordsOccurences
free bitcoins every5
bitcoins every hour5
200 in free5
up to 2003
create an account3
2 factor authentication3
play now play3
now play now3
your favorite events3
color fff important3
play now9
every hour7
free bitcoins7
color fff6
bitcoins every5
our website5
your computer4
we may4
your account4
please enter4
if you4
send you3
email address3
password reset3
no-repeat 03
website we3
important text-decoration3
important padding-left3
1 bitcoin3
fff important3
favorite events3
your favorite3
provably fair3
now play3
factor authentication3
2 factor3
do not3
address password3
weekly lottery3
every time3
your32
you25
important23
bitcoin18
website15
free13
please12
every12
our11
we11
play11
bitcoins11
up10
now9
color9
win9
cookies9
account9
if9
address8
us8
may8
password8
hour7
hi-lo7
use7
reset7
fff6
game6
06
btc6
no6
not6
using5
contest5
below5
freebitcoin5
enter5
do5
information5
15
lottery5
text-decoration4
login4
24
computer4
fair4
send4
tickets4
interest4
background4
referral4
2fa4
service4
email4
padding-left3
used3
improve3
no-repeat3
experience3
get3
all3
any3
have3
uses3
factor3
events3
policy3
33
nbspwin3
playing3
weekly3
big3
prizes3
lamborghini3
golden3
create3
e-mail3
documentreadyfunction3
43
favorite3
authentication3
users3
try3
simple3
provably3
multiply3
time3
over3
wagering3
dice3
bet3
provide3

Who hosts Freebitco.in?

Freebitco.in Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:CloudFlare

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%

HTTP Header Analysis for Freebitco.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 14 Jun 2021 03:05:18 GMT
Content-Type: text/html; charset=ISO-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Vary: User-Agent
Cache-Control: max-age=0, private, no-store, no-cache, must-revalidate
Expires: Mon, 14 Jun 2021 03:05:18 GMT
CF-Cache-Status: DYNAMIC
cf-request-id: 0aaa141d930000076afb934000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 65f0560f5a71076a-LHR
Content-Encoding: gzip

Freebitco.in Domain Nameserver Information

HostIP AddressCountry
tom.ns.cloudflare.com 108.162.193.147
dina.ns.cloudflare.com 172.64.32.107


Need to find out who hosts Freebitco.in?


Domain Registration (WhoIs) information for Freebitco.in

 Domain Name: freebitco.in
Registry Domain ID: D7766450-IN
Registrar WHOIS Server:
Registrar URL: www.enom.com
Updated Date: 2020-04-17T04:03:38Z
Creation Date: 2013-10-10T19:29:11Z
Registry Expiry Date: 2025-10-10T19:29:11Z
Registrar: eNom, LLC
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok http://www.icann.org/epp#OK
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization:
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: San Jose
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: CR
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: tom.ns.cloudflare.com
Name Server: dina.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-06-14T03:05:18Z

Websites with Similar Names

Freeb.asia
Dot.Asia | From Asia / For Asia
Freeb.club
Kostenlose Proben frei Haus - Kostenlose Produktproben, Tests und Gutscheine
Freeb.design
404 Not Found
Freeb.jp
パーソナルジムfis大阪~ダイエット・筋力UP・骨格(骨盤)矯正~

Recently Updated Websites

Ol-kit.info (1 second ago.)Memoryglass.net (3 seconds ago.)Boyu344.com (4 seconds ago.)Bassfriendly.com (5 seconds ago.)1milreviews.com (5 seconds ago.)Starskysbargrill.com (6 seconds ago.)Ictcentrale.online (6 seconds ago.)Aaa-skincare.net (6 seconds ago.)Wiredforwork.org (7 seconds ago.)Allproinsulationok.org (8 seconds ago.)Sabongbest.live (9 seconds ago.)Watermeloncreekchurch.com (9 seconds ago.)Paysoncarpenters.com (11 seconds ago.)Nlcc.ca (12 seconds ago.)Nsg.team (13 seconds ago.)Jerri-fort.xyz (14 seconds ago.)Stephenalter.com (14 seconds ago.)Global-licensinggh.com (14 seconds ago.)Sqdrum.com (14 seconds ago.)Lukydron.cz (16 seconds ago.)Theworkcode.org (18 seconds ago.)Daenji.com (18 seconds ago.)Chengzi22.com (19 seconds ago.)Nottycanada.com (20 seconds ago.)Tespotensi.com (20 seconds ago.)Revsnews.com (24 seconds ago.)Thebradleyhouseassistedliving.com (24 seconds ago.)Artbyannariikka.com (24 seconds ago.)Chattanoogariverboat.com (25 seconds ago.)Mercbasketball.com (26 seconds ago.)

Recently Searched Keywords

サトウヒサト (1 second ago.)fab i banking corporate online banking (2 seconds ago.)khogiare.com (3 seconds ago.)we need both (3 seconds ago.)8600 gtx (5 seconds ago.)pop up stand (10 seconds ago.)wettbewerbsbeobachtung auf englisch (12 seconds ago.)ქართული ოცნების საპარლამენტო სია (13 seconds ago.)joining page (16 seconds ago.)iconic accessories acnl (17 seconds ago.)lectors and commentators guide (18 seconds ago.)operating model ensures (19 seconds ago.)take a minute girl (21 seconds ago.)yak-shave.jpeg (23 seconds ago.)pension fund chair statement (24 seconds ago.)全国汽车配件交易行 (26 seconds ago.)building a new facility in phoenix, az (28 seconds ago.)apple silicon macs (28 seconds ago.)forbidden photos and videos from nudist beach (29 seconds ago.)airlock design (31 seconds ago.)куман: я потратил больше времени, наблюдая за разминкой марадоны, чем разминался сам (35 seconds ago.)odbornã© konzultace i slevy na recept lã©kã¡rny knl (36 seconds ago.)produktion (38 seconds ago.)uzay m (39 seconds ago.)توری مرغی (39 seconds ago.)k2 (pakistan) (40 seconds ago.)pro reviewsony (41 seconds ago.)ущерба при заливе квартиры (42 seconds ago.)สื่อมั่ว (45 seconds ago.)wireless pa (47 seconds ago.)