Freebookspot.es  |  FreeBookSpot | Download e-books for free
Low trust score  | 

Freebookspot.es Website Information

Freebookspot.es has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 13,952, a Majestic Rank of 272,391, a Domain Authority of 38% and is not listed in DMOZ.

Freebookspot.es is hosted by JSC ISPsystem in Irkutsk, Irkutsk, Russian Federation, 664017.
Freebookspot.es has an IP Address of 94.250.251.232 and a hostname of stankoproekt.ru.

The domain freebookspot.es was registered 201 decades 9 years 4 days ago by , it was last modified 201 decades 9 years 4 days ago and currently is set to expire 201 decades 9 years 4 days ago.


Who hosts Freebookspot.es?

Freebookspot.es Web Server Information

Hosted IP Address:94.250.251.232
Hosted Hostname:stankoproekt.ru
Service Provider:JSC ISPsystem
Hosted Country:RussiaRU
Location Latitude:52.2978
Location Longitude:104.296
Webserver Software:Not Applicable

HTTP Header Analysis for Freebookspot.es

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
Date: Sat, 13 Jun 2015 04:43:57 GMT
Content-Length: 21366


Need to find out who hosts Freebookspot.es?

Freebookspot.es Free SEO Report

Website Inpage Analysis for Freebookspot.es

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Freebookspot.es

membermoreonlynbspaddsiteyourebookscommentsfindothercan findisssl httpshttpspremiumvarlinksif youlatestcanyou canissslfreelinkhaveengineeringanysitesnewyou can findbooksifyoupmoldbookdownload

Longtail Keyword Density for Freebookspot.es

KeywordsOccurences
you can find3
isssl https4
if you4
you can4
can find3
you14
nbsp10
other8
books8
engineering7
free6
isssl6
only5
add4
your4
pmoldbook4
can4
have4
download4
if4
https4
var4
comments4
new4
ebooks3
link3
site3
member3
latest3
any3
links3
premium3
more3
find3
sites3

What are the nameservers for freebookspot.es?


Freebookspot.es Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Freebookspot.es is a scam?