Low trust score |
Finding free camping locations is easy! Use our interactive map to find the best free camping sites and go camping for free!
Freecampsites.net Website Information
Website Ranks & Scores for Freecampsites.net
 Statvoo Rank: | G |
 Alexa Rank: | 276,447 |
 Majestic Rank: | 301,910 |
 Domain Authority: | 41% |
 DMOZ Listing: | No |
Whois information for freecampsites.net
Full Whois Lookup for Freecampsites.net Whois Lookup
WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Freecampsites.net. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.
Domain Name: FREECAMPSITES.NET
Registry Domain ID: 1533457382_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2016-12-04T03:35:10Z
Creation Date: 2008-12-17T06:27:17Z
Registry Expiry Date: 2017-12-17T06:27:17Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS211.HOSTGATOR.COM
Name Server: NS212.HOSTGATOR.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-19T21:55:48Z
Who hosts Freecampsites.net?
Freecampsites.net is hosted by Google Inc. in California, Mountain View, United States, 94043.
Freecampsites.net has an IP Address of 104.197.11.67 and a hostname of 67.11.197.104.bc.googleusercontent.com and runs nginx/1.6.2 web server.
Freecampsites.net Web Server Information
| Hosted IP Address: | 104.197.11.67 |
| Hosted Hostname: | 67.11.197.104.bc.googleusercontent.com |
| Service Provider: | Google Inc. |
| Hosted Country: |  US |
| Location Latitude: | 37.4192 |
| Location Longitude: | -122.0574 |
| Webserver Software: | nginx/1.6.2 |
HTTP Header Analysis for Freecampsites.net
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Server: | nginx/1.6.2 |
| Date: | Mon, 27 Jul 2015 11:19:07 GMT |
| Content-Type: | text/html; charset=UTF-8 |
| Transfer-Encoding: | chunked |
| Connection: | keep-alive |
| X-Pingback: | http://freecampsites.net/xmlrpc.php |
| Content-Encoding: | gzip |
Need to find out who hosts Freecampsites.net?
Freecampsites.net Free SEO Report
Website Inpage Analysis for Freecampsites.net
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | pub-2766087374245148 | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Freecampsites.net
entrygoogletagcmdpushfunctionalongvacationwhether youlocationthererangeyou likeif youstoplocation settingswindowlocationhashapplicationcamping wecoastphotostruckmay pause trackinghardwarejusthorsekeepshootingviewinggpsoptimizedescriptionyour next campingmakesyour browseruse our tripargumentscalleelistingcampingtrip plannerwellrvbrowsersiteinfotypespecificcampsitetype2siteinfotypespecificmaxrvsizeforestfree camping areasparktrackingmilesresearchclasspausetripgeolocationyou may wishdescription descriptionyour geolocation optionsrv class1varyou findif siteinfotypespecificcampsitetypeone of thesemay pauseknowgeolocation optionspleasewe hopefind campingfree campingogimagename rating popularitywhethersearch withoutcampfeetyou canfalsetruestoragecamping roaddisable geogivename ratingplacesrv parkingcamping near youlandsyour nextelsewouldreviewsprivateplannerhelpcampsitetype2otherhidepartslengthfindgeolocationyou maydumpappcacheready2checkmanagement areasoftenthisvalueaccessrating popularityneedplaces to golengthargumentscallee falsefavoritesgps gps gpscamp sitesmany of thesedestinationsland managementkindwish to changefree camping roadtruetriggerhandlerchange ifnameaccessibleselectwithout geolocationyouhave morecostdataphonecamping areasmoregootherwildlifegeolocationmapgive youhashinformationyou maysportswelcomeservicewould youyou havealong yourseefunctiondisable geo locationareasthischeckedbasedroad tripevenelse ifspendallvar i 0youofflinetentcampsiteswould you likeratingbeennext campingpropchecked truetriggerhandlerchangeifchange your geolocationtimetrailscommunityoptionsusmanagementlesspaycampgroundswithout geolocationyou mayaddsearch without geolocationyoupropchecked truetriggerhandlerchange ifcampgroundcorralpropcheckedoutour tripviewmay needpublichereuser reviewsbureautablesnextpartslength description descriptioncampsitetype2publichidetracking and searchfind camping nearsortsitescanwishenableparkingaddingdirectionsanywithouthopeusenetworkhelp youfind freenear youroutebureau of landcamping informationrecentgrillrampsettingsroadgeogethashreplacehaveavailabletruck stopheadappendfindingyou may needwevenottakechangelikedisablewantunablefreesomelistingsplannearcampsitepartslength descriptionyour networkdemand or disablenearbywebsiteyescamping nearpopularityhidedetailsprovidelistedstaydemanduserrequiredlocal storagedatemaximumourthesecountybestcontactwatersiteinfotypespecificcampsitetypegeolocationyouenjoystationcamping road tripmostmay wishwedidyour geolocationsearchyoursiteinfotypespecificnumsitesyour routeagaintruetriggerhandlerchangering0easylocalfeaturesgps gpschange yourgo campingmanyclimbingblogmaygeo locationyou enjoyuse ourspend lessyou wantthanonecampsitetype2privatehidesiteinfotypespecificroadtypeour trip plannercamping tripforest servicethempavedlocationsstatepause trackinglisted heresiteif thisvaluelandsharingtent camping
Longtail Keyword Density for Freecampsites.net
| Keywords | Occurences |
|---|---|
| propchecked truetriggerhandlerchange if | 6 |
| our trip planner | 6 |
| partslength description description | 4 |
| camping near you | 4 |
| name rating popularity | 4 |
| your next camping | 4 |
| use our trip | 4 |
| var i 0 | 4 |
| free camping areas | 4 |
| places to go | 4 |
| gps gps gps | 3 |
| would you like | 3 |
| free camping road | 3 |
| find camping near | 3 |
| camping road trip | 3 |
| disable geo location | 3 |
| your geolocation options | 3 |
| you may need | 3 |
| may pause tracking | 3 |
| one of these | 3 |
| many of these | 3 |
| bureau of land | 3 |
| tracking and search | 3 |
| search without geolocationyou | 3 |
| change your geolocation | 3 |
| wish to change | 3 |
| geolocationyou may wish | 3 |
| without geolocationyou may | 3 |
| demand or disable | 3 |
| free camping | 17 |
| trip planner | 10 |
| else if | 9 |
| you have | 7 |
| description description | 7 |
| propchecked truetriggerhandlerchange | 7 |
| next camping | 6 |
| our trip | 6 |
| if thisvalue | 6 |
| camping areas | 6 |
| truetriggerhandlerchange if | 6 |
| would you | 6 |
| your next | 6 |
| you can | 5 |
| road trip | 5 |
| you find | 5 |
| camp sites | 5 |
| camping near | 5 |
| use our | 5 |
| find free | 4 |
| help you | 4 |
| gps gps | 4 |
| near you | 4 |
| your route | 4 |
| you like | 4 |
| camping information | 4 |
| user reviews | 4 |
| rv parking | 4 |
| tent camping | 4 |
| management areas | 4 |
| rv class | 4 |
| partslength description | 4 |
| name rating | 4 |
| rating popularity | 4 |
| if you | 4 |
| camping we | 4 |
| spend less | 4 |
| we hope | 4 |
| you may | 4 |
| go camping | 4 |
| you enjoy | 4 |
| argumentscallee false | 3 |
| whether you | 3 |
| along your | 3 |
| give you | 3 |
| camping trip | 3 |
| find camping | 3 |
| your network | 3 |
| your browser | 3 |
| may need | 3 |
| location settings | 3 |
| may pause | 3 |
| local storage | 3 |
| listed here | 3 |
| forest service | 3 |
| land management | 3 |
| truck stop | 3 |
| if siteinfotypespecificcampsitetype | 3 |
| pause tracking | 3 |
| search without | 3 |
| disable geo | 3 |
| geo location | 3 |
| have more | 3 |
| you want | 3 |
| geolocation options | 3 |
| your geolocation | 3 |
| without geolocationyou | 3 |
| geolocationyou may | 3 |
| may wish | 3 |
| change your | 3 |
| camping road | 3 |
| you | 65 |
| camping | 54 |
| if | 52 |
| your | 40 |
| free | 26 |
| we | 24 |
| description | 21 |
| our | 20 |
| var | 19 |
| else | 17 |
| trip | 16 |
| rv | 16 |
| find | 16 |
| have | 15 |
| more | 14 |
| campsite | 14 |
| may | 14 |
| route | 13 |
| information | 12 |
| well | 12 |
| not | 12 |
| gps | 11 |
| planner | 11 |
| all | 11 |
| other | 10 |
| function | 10 |
| use | 10 |
| these | 10 |
| can | 10 |
| areas | 10 |
| camp | 9 |
| truetriggerhandlerchange | 9 |
| propchecked | 9 |
| miles | 9 |
| location | 9 |
| campsites | 9 |
| many | 9 |
| sites | 9 |
| here | 9 |
| search | 9 |
| tent | 8 |
| next | 8 |
| road | 8 |
| add | 8 |
| false | 8 |
| hash | 8 |
| land | 8 |
| near | 8 |
| water | 8 |
| community | 8 |
| help | 8 |
| site | 8 |
| reviews | 8 |
| like | 8 |
| required | 7 |
| public | 7 |
| best | 7 |
| settings | 7 |
| shooting | 7 |
| parking | 7 |
| time | 7 |
| access | 7 |
| any | 6 |
| places | 6 |
| thischecked | 6 |
| easy | 6 |
| campgrounds | 6 |
| need | 6 |
| plan | 6 |
| options | 6 |
| geolocation | 6 |
| along | 6 |
| thisvalue | 6 |
| length | 6 |
| would | 6 |
| less | 6 |
| private | 6 |
| management | 5 |
| campsitetype2otherhide | 5 |
| there | 5 |
| them | 5 |
| wildlife | 5 |
| feet | 5 |
| us | 5 |
| out | 5 |
| listed | 5 |
| know | 5 |
| application | 5 |
| go | 5 |
| please | 5 |
| googletagcmdpushfunction | 5 |
| some | 5 |
| see | 5 |
| sports | 5 |
| service | 5 |
| name | 5 |
| makes | 4 |
| data | 4 |
| features | 4 |
| truck | 4 |
| pay | 4 |
| local | 4 |
| disable | 4 |
| browser | 4 |
| tracking | 4 |
| horse | 4 |
| map | 4 |
| even | 4 |
| coast | 4 |
| bureau | 4 |
| unable | 4 |
| forest | 4 |
| network | 4 |
| one | 4 |
| select | 4 |
| siteinfotypespecificcampsitetype | 4 |
| enjoy | 4 |
| stop | 4 |
| user | 4 |
| lands | 4 |
| locations | 4 |
| partslength | 4 |
| headappend | 4 |
| than | 4 |
| appcacheready | 4 |
| rating | 4 |
| spend | 4 |
| sharing | 4 |
| class | 4 |
| phone | 4 |
| listings | 4 |
| hardware | 4 |
| adding | 4 |
| 0 | 4 |
| true | 4 |
| popularity | 4 |
| hope | 4 |
| based | 3 |
| favorites | 3 |
| optimize | 3 |
| check | 3 |
| directions | 3 |
| photos | 3 |
| finding | 3 |
| 1 | 3 |
| nearby | 3 |
| recent | 3 |
| ogimage | 3 |
| destinations | 3 |
| vacation | 3 |
| windowlocationhash | 3 |
| gethashreplace | 3 |
| argumentscallee | 3 |
| sort | 3 |
| most | 3 |
| whether | 3 |
| weve | 3 |
| want | 3 |
| just | 3 |
| contact | 3 |
| give | 3 |
| provide | 3 |
| available | 3 |
| date | 3 |
| without | 3 |
| maximum | 3 |
| siteinfotypespecificnumsites | 3 |
| 2 | 3 |
| paved | 3 |
| accessible | 3 |
| siteinfotypespecificmaxrvsize | 3 |
| siteinfotypespecificroadtype | 3 |
| again | 3 |
| campsitetype2publichide | 3 |
| hidedetails | 3 |
| blog | 3 |
| siteinfotypespecificcampsitetype2 | 3 |
| entry | 3 |
| grill | 3 |
| tables | 3 |
| station | 3 |
| welcome | 3 |
| ring | 3 |
| corral | 3 |
| range | 3 |
| dump | 3 |
| viewing | 3 |
| climbing | 3 |
| trails | 3 |
| ramp | 3 |
| campsitetype2privatehide | 3 |
| stay | 3 |
| change | 3 |
| demand | 3 |
| wish | 3 |
| geolocationyou | 3 |
| kind | 3 |
| geo | 3 |
| cost | 3 |
| offline | 3 |
| take | 3 |
| keep | 3 |
| did | 3 |
| pause | 3 |
| park | 3 |
| often | 3 |
| campground | 3 |
| research | 3 |
| been | 3 |
| yes | 3 |
| county | 3 |
| state | 3 |
| enable | 3 |
| storage | 3 |
| website | 3 |
| view | 3 |
| listing | 3 |