Website Analysis Summary  |  Map of Free Camping Areas | Go Camping for Free!
Low trust score  | 
Finding free camping locations is easy! Use our interactive map to find the best free camping sites and go camping for free!

Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income
0 has a Low Trust Score, and a Statvoo Rank of G. is hosted by Google Inc. in California, Mountain View, United States, 94043. has an IP Address of and a hostname of and runs nginx/1.6.2 web server.

The domain was registered 1 decade 1 year 1 month ago by , it was last modified 5 years 2 months 3 weeks ago and currently is set to expire 4 years 1 month 5 days ago.

It is the world's 255,725 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 4,476 unique visitors a day and 24,088 pageviews per day. has an estimated worth of $36,180.
An average daily income of approximately $67, which is wroughly $2,038 per month.

Whois information for

Full Whois Lookup for Whois Lookup

Registry Domain ID: 1533457382_DOMAIN_NET-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2016-12-04T03:35:10Z
Creation Date: 2008-12-17T06:27:17Z
Registry Expiry Date: 2017-12-17T06:27:17Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Name Server: NS211.HOSTGATOR.COM
Name Server: NS212.HOSTGATOR.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-19T21:55:48Z

Who hosts Web Server Information

Hosted IP Address:
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4192
Location Longitude:-122.0574
Webserver Software:nginx/1.6.2

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.6.2
Date: Mon, 27 Jul 2015 11:19:07 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:1
H2 Headings:1
H3 Headings:1
H4 Headings:1
H5 Headings:1
H6 Headings:1
Total IFRAMEs:0
Total Images:14
Google Adsense:pub-2766087374245148
Google Analytics:Not Applicable

Keyword Cloud for

rangeheadappendphoneyour next campingvacationcamp sitesfind freegps gpsfindcamping triplessservicebestroutewish to changedumpfunctionroadmayweveblogelse ifkindofflinephotoschange yourcamping informationyou maywatergeolocation optionspleaseyour geolocationroad tripfree camping areascampsitesparkingmilesfalseaddingsiteinfotypespecificmaxrvsizemaximumstorageforestfeaturessharingtakefavoritesyour browseroutthisvaluedirectionsmostcamping wename ratingdisable geo locationlocationhelp youogimageifyouchangeratingmanydescriptionyour routevar i 0userif siteinfotypespecificcampsitetypesitesselectunablepropcheckedmay pausecostpaysiteinfotypespecificnumsiteslocationstheselocation settingscamping road tripfeetlistingonenear youstopringsortspend lesstrip plannerlandrequiredaccessiblesiteinfotypespecificcampsitetype2rating popularitygethashreplaceherehorsecontactdisablemanagement areasfindingtentmoresiteinfotypespecificcampsitetypeweclasswildlifestaywould youcampsitetype2privatehideview0change your geolocationtablespartslength descriptiondemand or disablegpspausetruetriggerhandlerchangecampgiveaccessalong yourgo campingyou may needforest servicevarfree camping roadbrowsergeolocationyou mayprovideknowcampingstationcampgroundsfreeusehashhave morekeepwithout geolocationyou maytripfind campingyou findif thisvaluerampuser reviewsgeolocationyoupartslengthcampsitetype2otherhidewantwould you likehardwarenextpublicfind camping nearspendyou wantbeencheckcorralgeo locationcountysomeoftenareasplacesnearbyeasyoptimizeour tripclimbingpopularityelserv parkingyour networkcampsitetype2publichidemanagementtimenamerecentpartslength description descriptiongeolocationyou may wishif youthischeckedour2informationcampgroundwithoutpause trackingparkargumentscallee falselisteddescription descriptiongoogletagcmdpushfunctionmaprvalongdataresearchbasedhavegive youjustdidhopesearchentryrv classlistingsgrilllisted herenearwouldname rating popularityreviewsenablewellcamping roadmay needlocalgoprivatecamping areastracking and searchsearch without geolocationyouyouryour nextcoastyou enjoysiteinfotypespecificroadtypemay wishstateeventruck stopmakesyescamping nearwindowlocationhashlocal storageuse our tripsettingsappcachereadyoptionsargumentscalleewelcomewhetherenjoydemandshootinggps gps gpspropchecked truetriggerhandlerchangepropchecked truetriggerhandlerchange ifgeolikewe hopenext campinguse ourneeddestinationsland managementhidedetailscanpavedsiteseeagainthemdatesportsmay pause trackingyour geolocation optionsgeolocationtrackingtrailsyou likebureauthanmany of theseyou havewithout geolocationyoutherewishtent camping1camping near youplaces to goviewingapplicationplannotcampsitefree campingotherone of theseanyour trip plannerlengthtruckwhether younetworkdisable geouslandsbureau of landwebsitetrueyou cancommunityalladdhelpsearch withoutavailableplannertruetriggerhandlerchange if

Longtail Keyword Density for

propchecked truetriggerhandlerchange if6
our trip planner6
partslength description description4
camping near you4
name rating popularity4
your next camping4
use our trip4
var i 04
free camping areas4
places to go4
gps gps gps3
would you like3
free camping road3
find camping near3
camping road trip3
disable geo location3
your geolocation options3
you may need3
may pause tracking3
one of these3
many of these3
bureau of land3
tracking and search3
search without geolocationyou3
change your geolocation3
wish to change3
geolocationyou may wish3
without geolocationyou may3
demand or disable3
free camping17
trip planner10
else if9
you have7
description description7
propchecked truetriggerhandlerchange7
next camping6
our trip6
if thisvalue6
camping areas6
truetriggerhandlerchange if6
would you6
your next6
you can5
road trip5
you find5
camp sites5
camping near5
use our5
find free4
help you4
gps gps4
near you4
your route4
you like4
camping information4
user reviews4
rv parking4
tent camping4
management areas4
rv class4
partslength description4
name rating4
rating popularity4
if you4
camping we4
spend less4
we hope4
you may4
go camping4
you enjoy4
argumentscallee false3
whether you3
along your3
give you3
camping trip3
find camping3
your network3
your browser3
may need3
location settings3
may pause3
local storage3
listed here3
forest service3
land management3
truck stop3
if siteinfotypespecificcampsitetype3
pause tracking3
search without3
disable geo3
geo location3
have more3
you want3
geolocation options3
your geolocation3
without geolocationyou3
geolocationyou may3
may wish3
change your3
camping road3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry