Freecampsites.net Website Analysis Summary
Low trust score |
Finding free camping locations is easy! Use our interactive map to find the best free camping sites and go camping for free!
| Rank | 255,725 |
| Rating | G |
| Trust Score | Low Trust Score |
| Estimated worth | $36,180 |
| Estimated daily income | $67 |
| Estimated monthly income | $2,038 |
| Backlinks | 0 |
Freecampsites.net has a Low Trust Score, and a Statvoo Rank of G.
Freecampsites.net is hosted by Google Inc. in California, Mountain View, United States, 94043.
Freecampsites.net has an IP Address of 104.197.11.67 and a hostname of 67.11.197.104.bc.googleusercontent.com and runs nginx/1.6.2 web server.
The domain freecampsites.net was registered 1 decade 1 year 1 month ago by , it was last modified 5 years 2 months 3 weeks ago and currently is set to expire 4 years 1 month 5 days ago.
It is the world's 255,725 most popular site among over 300 million websites.
Freecampsites.net has a total of 0 backlinks.
Freecampsites.net gets approximately 4,476 unique visitors a day and 24,088 pageviews per day.
Freecampsites.net has an estimated worth of $36,180.
An average daily income of approximately $67, which is wroughly $2,038 per month.
Whois information for freecampsites.net
Full Whois Lookup for Freecampsites.net Whois Lookup
Domain Name: FREECAMPSITES.NET
Registry Domain ID: 1533457382_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2016-12-04T03:35:10Z
Creation Date: 2008-12-17T06:27:17Z
Registry Expiry Date: 2017-12-17T06:27:17Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS211.HOSTGATOR.COM
Name Server: NS212.HOSTGATOR.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-19T21:55:48Z
Who hosts Freecampsites.net?
Freecampsites.net Web Server Information
| Hosted IP Address: | 104.197.11.67 |
| Hosted Hostname: | 67.11.197.104.bc.googleusercontent.com |
| Service Provider: | Google Inc. |
| Hosted Country: |  US |
| Location Latitude: | 37.4192 |
| Location Longitude: | -122.0574 |
| Webserver Software: | nginx/1.6.2 |
HTTP Header Analysis for Freecampsites.net
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Server: | nginx/1.6.2 |
| Date: | Mon, 27 Jul 2015 11:19:07 GMT |
| Content-Type: | text/html; charset=UTF-8 |
| Transfer-Encoding: | chunked |
| Connection: | keep-alive |
| X-Pingback: | http://freecampsites.net/xmlrpc.php |
| Content-Encoding: | gzip |
Need to find out who hosts Freecampsites.net?
Freecampsites.net Free SEO Report
Website Inpage Analysis for Freecampsites.net
| H1 Headings: | 1 | 1 | |
| H2 Headings: | 1 | 5 | |
| H3 Headings: | 1 | 0 | |
| H4 Headings: | 1 | 0 | |
| H5 Headings: | 1 | 0 | |
| H6 Headings: | 1 | 0 | |
| Total IFRAMEs: | 0 | ||
| Total Images: | 14 | ||
| Google Adsense: | pub-2766087374245148 | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Freecampsites.net
rangeheadappendphoneyour next campingvacationcamp sitesfind freegps gpsfindcamping triplessservicebestroutewish to changedumpfunctionroadmayweveblogelse ifkindofflinephotoschange yourcamping informationyou maywatergeolocation optionspleaseyour geolocationroad tripfree camping areascampsitesparkingmilesfalseaddingsiteinfotypespecificmaxrvsizemaximumstorageforestfeaturessharingtakefavoritesyour browseroutthisvaluedirectionsmostcamping wename ratingdisable geo locationlocationhelp youogimageifyouchangeratingmanydescriptionyour routevar i 0userif siteinfotypespecificcampsitetypesitesselectunablepropcheckedmay pausecostpaysiteinfotypespecificnumsiteslocationstheselocation settingscamping road tripfeetlistingonenear youstopringsortspend lesstrip plannerlandrequiredaccessiblesiteinfotypespecificcampsitetype2rating popularitygethashreplaceherehorsecontactdisablemanagement areasfindingtentmoresiteinfotypespecificcampsitetypeweclasswildlifestaywould youcampsitetype2privatehideview0change your geolocationtablespartslength descriptiondemand or disablegpspausetruetriggerhandlerchangecampgiveaccessalong yourgo campingyou may needforest servicevarfree camping roadbrowsergeolocationyou mayprovideknowcampingstationcampgroundsfreeusehashhave morekeepwithout geolocationyou maytripfind campingyou findif thisvaluerampuser reviewsgeolocationyoupartslengthcampsitetype2otherhidewantwould you likehardwarenextpublicfind camping nearspendyou wantbeencheckcorralgeo locationcountysomeoftenareasplacesnearbyeasyoptimizeour tripclimbingpopularityelserv parkingyour networkcampsitetype2publichidemanagementtimenamerecentpartslength description descriptiongeolocationyou may wishif youthischeckedour2informationcampgroundwithoutpause trackingparkargumentscallee falselisteddescription descriptiongoogletagcmdpushfunctionmaprvalongdataresearchbasedhavegive youjustdidhopesearchentryrv classlistingsgrilllisted herenearwouldname rating popularityreviewsenablewellcamping roadmay needlocalgoprivatecamping areastracking and searchsearch without geolocationyouyouryour nextcoastyou enjoysiteinfotypespecificroadtypemay wishstateeventruck stopmakesyescamping nearwindowlocationhashlocal storageuse our tripsettingsappcachereadyoptionsargumentscalleewelcomewhetherenjoydemandshootinggps gps gpspropchecked truetriggerhandlerchangepropchecked truetriggerhandlerchange ifgeolikewe hopenext campinguse ourneeddestinationsland managementhidedetailscanpavedsiteseeagainthemdatesportsmay pause trackingyour geolocation optionsgeolocationtrackingtrailsyou likebureauthanmany of theseyou havewithout geolocationyoutherewishtent camping1camping near youplaces to goviewingapplicationplannotcampsitefree campingotherone of theseanyour trip plannerlengthtruckwhether younetworkdisable geouslandsbureau of landwebsitetrueyou cancommunityalladdhelpsearch withoutavailableplannertruetriggerhandlerchange if
Longtail Keyword Density for Freecampsites.net
| Keywords | Occurences |
|---|---|
| propchecked truetriggerhandlerchange if | 6 |
| our trip planner | 6 |
| partslength description description | 4 |
| camping near you | 4 |
| name rating popularity | 4 |
| your next camping | 4 |
| use our trip | 4 |
| var i 0 | 4 |
| free camping areas | 4 |
| places to go | 4 |
| gps gps gps | 3 |
| would you like | 3 |
| free camping road | 3 |
| find camping near | 3 |
| camping road trip | 3 |
| disable geo location | 3 |
| your geolocation options | 3 |
| you may need | 3 |
| may pause tracking | 3 |
| one of these | 3 |
| many of these | 3 |
| bureau of land | 3 |
| tracking and search | 3 |
| search without geolocationyou | 3 |
| change your geolocation | 3 |
| wish to change | 3 |
| geolocationyou may wish | 3 |
| without geolocationyou may | 3 |
| demand or disable | 3 |
| free camping | 17 |
| trip planner | 10 |
| else if | 9 |
| you have | 7 |
| description description | 7 |
| propchecked truetriggerhandlerchange | 7 |
| next camping | 6 |
| our trip | 6 |
| if thisvalue | 6 |
| camping areas | 6 |
| truetriggerhandlerchange if | 6 |
| would you | 6 |
| your next | 6 |
| you can | 5 |
| road trip | 5 |
| you find | 5 |
| camp sites | 5 |
| camping near | 5 |
| use our | 5 |
| find free | 4 |
| help you | 4 |
| gps gps | 4 |
| near you | 4 |
| your route | 4 |
| you like | 4 |
| camping information | 4 |
| user reviews | 4 |
| rv parking | 4 |
| tent camping | 4 |
| management areas | 4 |
| rv class | 4 |
| partslength description | 4 |
| name rating | 4 |
| rating popularity | 4 |
| if you | 4 |
| camping we | 4 |
| spend less | 4 |
| we hope | 4 |
| you may | 4 |
| go camping | 4 |
| you enjoy | 4 |
| argumentscallee false | 3 |
| whether you | 3 |
| along your | 3 |
| give you | 3 |
| camping trip | 3 |
| find camping | 3 |
| your network | 3 |
| your browser | 3 |
| may need | 3 |
| location settings | 3 |
| may pause | 3 |
| local storage | 3 |
| listed here | 3 |
| forest service | 3 |
| land management | 3 |
| truck stop | 3 |
| if siteinfotypespecificcampsitetype | 3 |
| pause tracking | 3 |
| search without | 3 |
| disable geo | 3 |
| geo location | 3 |
| have more | 3 |
| you want | 3 |
| geolocation options | 3 |
| your geolocation | 3 |
| without geolocationyou | 3 |
| geolocationyou may | 3 |
| may wish | 3 |
| change your | 3 |
| camping road | 3 |
| you | 65 |
| camping | 54 |
| if | 52 |
| your | 40 |
| free | 26 |
| we | 24 |
| description | 21 |
| our | 20 |
| var | 19 |
| else | 17 |
| trip | 16 |
| rv | 16 |
| find | 16 |
| have | 15 |
| more | 14 |
| campsite | 14 |
| may | 14 |
| route | 13 |
| information | 12 |
| well | 12 |
| not | 12 |
| gps | 11 |
| planner | 11 |
| all | 11 |
| other | 10 |
| function | 10 |
| use | 10 |
| these | 10 |
| can | 10 |
| areas | 10 |
| camp | 9 |
| truetriggerhandlerchange | 9 |
| propchecked | 9 |
| miles | 9 |
| location | 9 |
| campsites | 9 |
| many | 9 |
| sites | 9 |
| here | 9 |
| search | 9 |
| tent | 8 |
| next | 8 |
| road | 8 |
| add | 8 |
| false | 8 |
| hash | 8 |
| land | 8 |
| near | 8 |
| water | 8 |
| community | 8 |
| help | 8 |
| site | 8 |
| reviews | 8 |
| like | 8 |
| required | 7 |
| public | 7 |
| best | 7 |
| settings | 7 |
| shooting | 7 |
| parking | 7 |
| time | 7 |
| access | 7 |
| any | 6 |
| places | 6 |
| thischecked | 6 |
| easy | 6 |
| campgrounds | 6 |
| need | 6 |
| plan | 6 |
| options | 6 |
| geolocation | 6 |
| along | 6 |
| thisvalue | 6 |
| length | 6 |
| would | 6 |
| less | 6 |
| private | 6 |
| management | 5 |
| campsitetype2otherhide | 5 |
| there | 5 |
| them | 5 |
| wildlife | 5 |
| feet | 5 |
| us | 5 |
| out | 5 |
| listed | 5 |
| know | 5 |
| application | 5 |
| go | 5 |
| please | 5 |
| googletagcmdpushfunction | 5 |
| some | 5 |
| see | 5 |
| sports | 5 |
| service | 5 |
| name | 5 |
| makes | 4 |
| data | 4 |
| features | 4 |
| truck | 4 |
| pay | 4 |
| local | 4 |
| disable | 4 |
| browser | 4 |
| tracking | 4 |
| horse | 4 |
| map | 4 |
| even | 4 |
| coast | 4 |
| bureau | 4 |
| unable | 4 |
| forest | 4 |
| network | 4 |
| one | 4 |
| select | 4 |
| siteinfotypespecificcampsitetype | 4 |
| enjoy | 4 |
| stop | 4 |
| user | 4 |
| lands | 4 |
| locations | 4 |
| partslength | 4 |
| headappend | 4 |
| than | 4 |
| appcacheready | 4 |
| rating | 4 |
| spend | 4 |
| sharing | 4 |
| class | 4 |
| phone | 4 |
| listings | 4 |
| hardware | 4 |
| adding | 4 |
| 0 | 4 |
| true | 4 |
| popularity | 4 |
| hope | 4 |
| based | 3 |
| favorites | 3 |
| optimize | 3 |
| check | 3 |
| directions | 3 |
| photos | 3 |
| finding | 3 |
| 1 | 3 |
| nearby | 3 |
| recent | 3 |
| ogimage | 3 |
| destinations | 3 |
| vacation | 3 |
| windowlocationhash | 3 |
| gethashreplace | 3 |
| argumentscallee | 3 |
| sort | 3 |
| most | 3 |
| whether | 3 |
| weve | 3 |
| want | 3 |
| just | 3 |
| contact | 3 |
| give | 3 |
| provide | 3 |
| available | 3 |
| date | 3 |
| without | 3 |
| maximum | 3 |
| siteinfotypespecificnumsites | 3 |
| 2 | 3 |
| paved | 3 |
| accessible | 3 |
| siteinfotypespecificmaxrvsize | 3 |
| siteinfotypespecificroadtype | 3 |
| again | 3 |
| campsitetype2publichide | 3 |
| hidedetails | 3 |
| blog | 3 |
| siteinfotypespecificcampsitetype2 | 3 |
| entry | 3 |
| grill | 3 |
| tables | 3 |
| station | 3 |
| welcome | 3 |
| ring | 3 |
| corral | 3 |
| range | 3 |
| dump | 3 |
| viewing | 3 |
| climbing | 3 |
| trails | 3 |
| ramp | 3 |
| campsitetype2privatehide | 3 |
| stay | 3 |
| change | 3 |
| demand | 3 |
| wish | 3 |
| geolocationyou | 3 |
| kind | 3 |
| geo | 3 |
| cost | 3 |
| offline | 3 |
| take | 3 |
| keep | 3 |
| did | 3 |
| pause | 3 |
| park | 3 |
| often | 3 |
| campground | 3 |
| research | 3 |
| been | 3 |
| yes | 3 |
| county | 3 |
| state | 3 |
| enable | 3 |
| storage | 3 |
| website | 3 |
| view | 3 |
| listing | 3 |
What are the nameservers for freecampsites.net?
Freecampsites.net Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| Unknown | Unknown | Unknown | Unknown |