Free Camping Near You | Go Camping for Free!

Safety: Low trust score
Year Founded: 2008
Global Traffic Rank: 96,611
Estimated Worth: $194,400

Finding free camping locations is easy! Use our interactive map to find camping near you or plan an epic free camping road trip with our trip planner.



Domain summary

Last updated
2020-10-09
Domain label
freecampsites
Domain extension
net
Domain registered:
2008-12-17
Domain updated:
2019-11-17
Global Traffic Rank
96,611
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$194,400
Estimated daily income
$270
Estimated monthly income
$8,213

Rank summary

How is freecampsites.net ranked relative to other sites:

Percentage of visits to freecampsites.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Freecampsites.net registered?
A: Freecampsites.net was registered 12 years, 3 months, 3 weeks, 4 days, 21 hours, 30 minutes, 38 seconds ago on Wednesday, December 17, 2008.
Q: When was the WHOIS for Freecampsites.net last updated?
A: The WHOIS entry was last updated 1 year, 4 months, 3 weeks, 3 days, 21 hours, 30 minutes, 38 seconds ago on Sunday, November 17, 2019.
Q: What are Freecampsites.net's nameservers?
A: DNS for Freecampsites.net is provided by the following nameservers:
  • ns211.hostgator.com
  • ns212.hostgator.com
Q: Who is the registrar for the Freecampsites.net domain?
A: The domain has been registered at NAMECHEAP INC..
Q: What is the traffic rank for Freecampsites.net?
A: Freecampsites.net ranks 96,611 globally on Alexa. Freecampsites.net has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Freecampsites.net each day?
A: Freecampsites.net receives approximately 22,485 visitors and 134,910 page impressions per day.
Q: What IP address does Freecampsites.net resolve to?
A: Freecampsites.net resolves to the IPv4 address 35.206.100.216.
Q: In what country are Freecampsites.net servers located in?
A: Freecampsites.net has servers located in the United States.
Q: What webserver software does Freecampsites.net use?
A: Freecampsites.net is powered by Nginx webserver.
Q: Who hosts Freecampsites.net?
A: Freecampsites.net is hosted by Merit Network Inc. in California, Mountain View, United States, 94043.
Q: How much is Freecampsites.net worth?
A: Freecampsites.net has an estimated worth of $194,400. An average daily income of approximately $270, which is roughly $8,213 per month.

Freecampsites.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Freecampsites.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Freecampsites.net

H1 Headings

1 :
  1. Camping near you. Find a Free Campsite

H2 Headings

4 :
  1. Trip Planner
  2. Add a Campsite
  3. Find a Campsite
  4. reviews

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

7:

Keyword Cloud for Freecampsites.net

viewmanywhetheroptionsdescription1tablesresearchlocationsyesmileshorserecentgeo locationparkwithout geolocationyou maymany of thesegeogeolocationhelppavedwateryour browseryou mayhereoftendumpmay pause trackingspendprivatesearch without geolocationyougoogletagcmdpushfunctionwhether youalong yourtruetriggerhandlerchangegeolocationyou maydestinationswildlifegivereviewsfeaturestentmay needsearchlessour tripentrylandsyou wantnameuser reviewslocation settingsyou canusfavoritesdescription descriptionmayeasythemlengthringlikesomephotosif youinformation0thischeckedcampsitestaylistedpleaseaddingagainchange your geolocationheadappendtruetriggerhandlerchange ifsearch withoutstateplanyouranynearoptimizeofflinekeeprampone of thesebasedratingyour nextapplicationcamping near youwish to changesiteinfotypespecificroadtypeland managementcamping wekindmaproutegpspaylocalmoremaximumforestfindingourname ratingsportscampsitetype2publichidesettingsnextusercampsitetype2otherhidevarroadbrowserwishtheregeolocationyou may wishrangehavecoastyour routehopeavailablegrillknowotherwelcomemay pausecanservicepartslength description descriptiongeolocation optionscountyrv classcampgroundcampgroundsfree campingthesespend lessgethashreplaceuse ouryou enjoycorraltripshootingwantevenseesiteinfotypespecificcampsitetype2hidedetailsmanagement areasusecamping nearlisted heretent campingstationchange yourcampname rating popularityvar i 0siteinfotypespecificnumsiteswould you likeblognewsiteinfotypespecificmaxrvsizeyour next campingparkingwouldpopularityselectwithout geolocationyouwellpropchecked truetriggerhandlerchangealongyou may needcamping informationyou likecosttakeplaceslistingpartslength descriptionnext campingmakesallcamping road tripfind camping nearrvpropcheckedpublicguidelinesdidif thisvalueovernight rv parkingaccesswithoutthandirectionsfind freedemandfree camping roadsiteinfotypespecificcampsitetypeplannerwould youtrailsphonepause trackingenjoydisable geonearbyovernightdemand or disablefreeyouuse our tripgeolocationyouwebsiteour trip plannerfindenablegps gps gpspropchecked truetriggerhandlerchange ifaddaccessibleogimagedisable geo locationyour geolocation optionsforest serviceclassnotbeenwe hopechangenear youtrackingsharingsubmissionlocationcamp sitesonecamping areasbureaufree camping areasmay wishprovideclimbingpartslengthcampingthisvalueareascampsitetype2privatehidefunctionif siteinfotypespecificcampsitetypehardwarestoptimecommunityplaces to gotruckmanagementcamping roadtruck stopgo campingrv parkingjustifcheckbureau of landcontactgps gpselse ifpausenetworktrip plannerunablebestdateyour geolocationfind campingmostwegive youtracking and searchcamping triphave morecampsitesyou findsortlistingsneedstorageovernight rvhelp youviewingsiteelseweveyou haveyour networkdisableroad triplanddatagorating popularityfeetvacationoutsitesrequiredlocal storage

Longtail Keyword Density for Freecampsites.net

KeywordsOccurences
our trip planner6
propchecked truetriggerhandlerchange if6
name rating popularity4
camping near you4
free camping areas4
places to go4
your next camping4
use our trip4
partslength description description4
var i 04
search without geolocationyou3
free camping road3
overnight rv parking3
many of these3
one of these3
you may need3
may pause tracking3
find camping near3
camping road trip3
tracking and search3
without geolocationyou may3
gps gps gps3
would you like3
disable geo location3
bureau of land3
your geolocation options3
change your geolocation3
wish to change3
geolocationyou may wish3
demand or disable3
free camping18
trip planner10
propchecked truetriggerhandlerchange7
description description7
you have7
camping areas6
your next6
next camping6
if thisvalue6
else if6
truetriggerhandlerchange if6
would you6
our trip6
road trip5
rv parking5
you find5
camp sites5
you can5
camping near5
use our5
your route4
near you4
gps gps4
we hope4
camping information4
find free4
help you4
spend less4
go camping4
user reviews4
you enjoy4
camping we4
management areas4
you like4
partslength description4
name rating4
tent camping4
rating popularity4
if you4
you may4
rv class4
local storage3
camping trip3
listed here3
if siteinfotypespecificcampsitetype3
whether you3
truck stop3
land management3
forest service3
overnight rv3
along your3
your browser3
may need3
geo location3
you want3
disable geo3
have more3
geolocation options3
your geolocation3
change your3
may wish3
geolocationyou may3
give you3
camping road3
without geolocationyou3
find camping3
search without3
pause tracking3
may pause3
location settings3
your network3
you65
camping55
if42
your40
free28
we24
description21
our20
rv18
trip16
have15
find15
more14
route14
may14
campsite14
not12
information12
well12
var12
planner11
all11
else11
gps11
can10
use10
these10
other10
areas10
googletagcmdpushfunction9
propchecked9
miles9
truetriggerhandlerchange9
campsites9
many9
sites9
camp9
location9
next9
near8
here8
parking8
search8
water8
road8
land8
tent8
like8
add8
help8
site8
reviews8
community8
public7
access7
shooting7
settings7
best7
required7
along6
options6
geolocation6
campgrounds6
less6
would6
places6
any6
easy6
thisvalue6
private6
length6
service6
time6
need6
plan6
thischecked6
them5
listed5
campsitetype2otherhide5
know5
there5
function5
guidelines5
us5
sports5
management5
some5
go5
please5
name5
feet5
out5
see5
wildlife5
partslength4
makes4
coast4
lands4
local4
even4
browser4
map4
enjoy4
user4
tracking4
spend4
sharing4
hope4
application4
adding4
hardware4
network4
one4
locations4
disable4
unable4
headappend4
class4
siteinfotypespecificcampsitetype4
horse4
truck4
phone4
stop4
than4
pay4
features4
bureau4
forest4
listings4
rating4
select4
04
popularity4
photos3
favorites3
want3
weve3
yes3
stay3
optimize3
date3
directions3
campground3
county3
check3
state3
just3
data3
give3
recent3
sort3
gethashreplace3
ogimage3
destinations3
vacation3
overnight3
available3
most3
provide3
whether3
contact3
submission3
did3
cost3
finding3
park3
kind3
listing3
nearby3
entry3
welcome3
tables3
storage3
website3
range3
trails3
climbing3
viewing3
siteinfotypespecificnumsites3
corral3
siteinfotypespecificmaxrvsize3
view3
siteinfotypespecificroadtype3
siteinfotypespecificcampsitetype23
hidedetails3
campsitetype2publichide3
new3
been3
often3
enable3
pause3
based3
accessible3
research3
again3
blog3
offline3
maximum3
13
take3
keep3
paved3
grill3
ring3
ramp3
geo3
dump3
demand3
station3
change3
wish3
geolocationyou3
without3
campsitetype2privatehide3

Who hosts Freecampsites.net?

Freecampsites.net Hosting Provider Information

Hosted IP Address:35.206.100.216
Hosted Hostname:216.100.206.35.bc.googleusercontent.com
Service Provider:Merit Network Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:nginx

Is "Merit Network Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%

HTTP Header Analysis for Freecampsites.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Fri, 09 Oct 2020 14:19:09 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://freecampsites.net/

Freecampsites.net Domain Nameserver Information

HostIP AddressCountry
ns211.hostgator.com 192.185.5.13
ns212.hostgator.com 192.185.5.130


Need to find out who hosts Freecampsites.net?


Domain Registration (WhoIs) information for Freecampsites.net

 Domain name: freecampsites.net
Registry Domain ID: 1533457382_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-11-17T06:12:33.02Z
Creation Date: 2008-12-17T06:27:17.00Z
Registrar Registration Expiration Date: 2020-12-17T06:27:17.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Redacted for Privacy Purposes
Registrant Name: Redacted for Privacy Purposes
Registrant Organization: Redacted for Privacy Purposes
Registrant Street: Redacted for Privacy Purposes
Registrant City: Redacted for Privacy Purposes
Registrant State/Province: S
Registrant Postal Code: Redacted for Privacy Purposes
Registrant Country: US
Registrant Phone: Redacted for Privacy Purposes
Registrant Phone Ext: Redacted for Privacy Purposes
Registrant Fax: Redacted for Privacy Purposes
Registrant Fax Ext: Redacted for Privacy Purposes
Registrant Email: Select Contact Domain Holder link at https://www.namecheap.com/domains/whois/result?domain=freecampsites.net
Registry Admin ID: Redacted for Privacy Purposes
Admin Name: Redacted for Privacy Purposes
Admin Organization: Redacted for Privacy Purposes
Admin Street: Redacted for Privacy Purposes
Admin City: Redacted for Privacy Purposes
Admin State/Province: Redacted for Privacy Purposes
Admin Postal Code: Redacted for Privacy Purposes
Admin Country: Redacted for Privacy Purposes
Admin Phone: Redacted for Privacy Purposes
Admin Phone Ext: Redacted for Privacy Purposes
Admin Fax: Redacted for Privacy Purposes
Admin Fax Ext: Redacted for Privacy Purposes
Admin Email: Select Contact Domain Holder link at https://www.namecheap.com/domains/whois/result?domain=freecampsites.net
Registry Tech ID: Redacted for Privacy Purposes
Tech Name: Redacted for Privacy Purposes
Tech Organization: Redacted for Privacy Purposes
Tech Street: Redacted for Privacy Purposes
Tech City: Redacted for Privacy Purposes
Tech State/Province: Redacted for Privacy Purposes
Tech Postal Code: Redacted for Privacy Purposes
Tech Country: Redacted for Privacy Purposes
Tech Phone: Redacted for Privacy Purposes
Tech Phone Ext: Redacted for Privacy Purposes
Tech Fax: Redacted for Privacy Purposes
Tech Fax Ext: Redacted for Privacy Purposes
Tech Email: Select Contact Domain Holder link at https://www.namecheap.com/domains/whois/result?domain=freecampsites.net
Name Server: ns211.hostgator.com
Name Server: ns212.hostgator.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-09-10T17:37:42.44Z

Websites with Similar Names

Freec.asia
freeC Asia | Công Nghệ Tuyển Dụng, Tìm Việc Làm Nhanh
Freec.com
freec.com -&nbspThis website is for sale! -&nbspfreec Resources and Information.
Freec.one
freec.one
Freec.top
FREEC - ?????? ??????? "??????"
Freec.xyz
Welcome to CentOS

Recently Updated Websites

Bezosprizefoundation.info (2 seconds ago.)Meanis.love (3 seconds ago.)Vivekkhannaadvisor.com (4 seconds ago.)Getacross80.com (4 seconds ago.)Dragonflysoftware.com (5 seconds ago.)Furniture--rental.com (6 seconds ago.)Fachkraft-fuer-arbeitssicherheit.biz (6 seconds ago.)Mabuhaycart.com (6 seconds ago.)Instaaxis.com (6 seconds ago.)Thesaltyadventurer.com (7 seconds ago.)Gt-trauer.de (7 seconds ago.)Westmorelandcensus.org (8 seconds ago.)Chmi.org (8 seconds ago.)Downtowneugenemassage.com (8 seconds ago.)Sfidastudios.com (8 seconds ago.)Q4designs.com (8 seconds ago.)Theemailconference.com (9 seconds ago.)Axuan5.xyz (9 seconds ago.)Juansinmiedo.art (9 seconds ago.)Mysphere.work (9 seconds ago.)Frantsuzoff.ru (9 seconds ago.)Kazamaura.com (10 seconds ago.)Dogtagspros.com (10 seconds ago.)Igunborenterprises.com (10 seconds ago.)Serviceexpert.help (10 seconds ago.)Revive20.net (10 seconds ago.)Globallakademi.com (10 seconds ago.)Royalsupervoce.com (10 seconds ago.)Jeroenvanhal.com (11 seconds ago.)Werebel.app (11 seconds ago.)

Recently Searched Keywords

construction clé en main (1 second ago.)aon (1 second ago.)st marcellin (1 second ago.)45a (3 seconds ago.)đà điểu giống (5 seconds ago.)usa jobs puerto rico buchanan (5 seconds ago.)windowddc windowddci18n (8 seconds ago.)jqueryextend windowddci18n windowddci18nlabels (9 seconds ago.)ludhiana call girls (9 seconds ago.)finger-rocket, un tower-defense orbital (mot copyrighté by moi please). je ferais peut-être une version complète avec scénario un jour. (10 seconds ago.)solemnly affirm (11 seconds ago.)25875ms infinite alternate (12 seconds ago.)zim (12 seconds ago.)tees training (13 seconds ago.)2px 9px 0px (15 seconds ago.)flex -webkit-box-orient vertical (16 seconds ago.)-moz-document url-prefix td-pulldown-syle-default (17 seconds ago.)logos (19 seconds ago.)mcxpricewala crude chart (19 seconds ago.)usa hotel jobs for foreigners (20 seconds ago.)isproductpage (21 seconds ago.)free national park entrance days 2017 (23 seconds ago.)маска с ремнями off-white (24 seconds ago.)aussizz group (26 seconds ago.)usa pilot jobs for foreigners (26 seconds ago.)xs flex front (27 seconds ago.)tile roofing (28 seconds ago.)them a red (29 seconds ago.)как сделать замену салонного фильтра на ладе калина (30 seconds ago.)video cnbc indonesia (31 seconds ago.)